Os08t0105000-02

Locus

Os08g0105000

Description

Zinc finger, RING/FYVE/PHD-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

EHD3

CGSNL Gene Name

EARLY HEADING DATE 3

Oryzabase Gene Symbol Synonym(s)

Ehd3, OsPHD36, PHD36

Oryzabase Gene Name Synonym(s)

Early heading date3, PHD transcription factor, Plant homeo-domain finger protein 36, PHD finger protein 36

Transcript Evidence

AK102613 (DDBJ, Best hit)

Protein Evidence

F1DK84 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, PHD-type (IPR001965)

Zinc finger, FYVE/PHD-type (IPR011011)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, PHD-finger (IPR019787)

Full-length cDNA

J033099D14 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0105000-02)

RiceXPro (AK102613)

Others

Oryzabase (9301)

KEGG (Os08t0105000-02)

Transcript

2149 bp

>Os08t0105000-02 Zinc finger, RING/FYVE/PHD-type domain containing protein.
TTTGTCTCCGGCTCCGCTCGCCGCCTCCAAATCCCGCTCCTCCGCTGCTGCTCCTCTCTG
CCGCGGCGAGGCGAGAGATCCGAATCCACCGCCACCCGCGCCCACCCCGCCCGCACAAAC
CCTAGTTTTTCCGGGGTTTTGCTTCCCCTCCGCAGCTCCGCTCCGCTCCGTCCGTCGTCT
CCTCCCGGCGGCTCGGCTTGCTGTCCATGCTGTAGCCGCCCCCCGCAGGTGGCTGATGGG
CTCCCAGAACCGCCCCCCACCACCGCGCAAGAGGCAGCCGCCGCCGCCGGAGGACCACCT
CGTCACCTACAAGCGCCGCCGCTCCAAAGAAACACAGCCTTTGCCACTCATGGCCAACGG
CGCCAATTCTAAGAAAGACGCCAAGGCCCAACATTGGATTAGCTGGAGGGACACTCTCCA
CGGCTTCCTCCAATCCCCTGCTATTAGCCAGGGTGGAGGAATTCAGACCTGCATCCGTCA
TGCTCTCCAACACAATCCTTGCTTGCTCACCAATGGTGTTGTTGTTCACACTGAATTCAA
AGGTAACCCAGCTCATTCCCAAGGAGAGGAAGCAAAAGTGCAGCACCCTAATGGTGCTGC
TGGAGGCAAGGTGGTTTCTGCAGATGCTGCTATACAAGATGCGGCTGCCGCAGCTTCTTC
CGAAGCTAACAAGGCAATGTGTAATAATGCCCTCTTCGACATTTTGGTCTCCCAGAAATT
TGCCTTGTTGTGCCATTTGCTACTTGGGACCTTCCATGTCAATAAACCTGGTGATGTCAT
CGACTTGGAAAAAATCGACGCCAAGATGAGAAATGGAGACTATGCCCACAACCCTGCACT
ATTTGACGATGATATCCAGCAGATGTGGGAGAAGTTTGAGCAAGTTGGCCAAGAGATGAC
AGGTCTAGCGAGCAACCTTTCAACCATTTCACGAGTTTCATACCAAAAGCAGGCTTCTGG
ATTTTCTGAAGCTGAGGTGGCTGAGCACAGAATAGAGGAAATAAGTTTGCCGGGTGCTGT
CCACGTTGTCACAAAGGAGTCGACTACCACCGTGCAGTTGGCCCCATGTGATTCTAGTCA
TTCTACAATACCGAAACGAACTGTGCCACCTGGACGTGATCTGTGCCCTTGCGATGGTTG
TGGCACCAAGGTAGATGTTGAAGAAGGCCTAATCTGTGATGAATGTGACACCATGTACCA
CTTTGCATGTGTCAAGCTACTCAATCCTGATATTAAGCAAGTCCCAGCAATCTGGCATTG
TTCAACCTGCAGCTTCAAGAAAAAAGAATTGGCTGCAGATACCACGAATAATGTTGCCCA
TGACTGCTTGCATGGTGGTAACTGTGTTTTGTGTGACCAGCTCGAGCTGGTGAAGACAGA
AGAAGAAGATCCCAAGCTTCCCATAAAAATTGAATTAGCTGAAGAAAGAGAGGGGAGCTC
CGTCTCAAGCATGGGGGAAGACAATGAACCAGACCTGTCAACAACTGCCCTGTCAAACTT
GTGCAAACACTGTGGCACATGCGAAGACGATGACAAGAGATTCATGGTATGCGGACATCC
TTACTGCGTTTACAAGTTCTATCATATCCGATGCCTGAAAACAAGCCAGCTTGCAATTGA
GCAACAAAAGAAGCTTGGTTGCTGGTACTGCCCCTCTTGCCTCTGCAGAGGGTGCTTCCA
AGACAAGGATGATGACCAGATAGTCATGTGTGATGGCTGTGATGAAGGTTATCACATATA
TTGCATGAGACCAGCACGCAACACTATCCCCAAAGGTAAGTGGTACTGTACATTTTGCAA
GATCCGCAGGGCAGCGGAAGGAATGCATAAGTATGAGGATTCTGTGCTGAAAATACATGG
GAATAGTAAGCATGCTTGTAATGTGAATCAGTCGAAGGATTCTGAAGGTGATGGTACTGA
AAAGTGATCATCACAATAGCTTTGTGGATTAGCTTCTGAGCTCGCTTGGACAAGCTCAGG
AAAAGAGATTCTTTGGCCCCTTAGGAGGGCTATACACCGACTTTGATACTGAATCAGTTG
TGTAGTTTATTTAATTAACTGCCGTTGACATCTACAGGAAGAACTCTTACCTGGTGAAGA
TGGTGTATGTAGTCTTTTAGCTGGGCGGAATGATGTGTTGTTTACTTGT

CDS

1692 bp

>Os08t0105000-02 Zinc finger, RING/FYVE/PHD-type domain containing protein.
ATGGGCTCCCAGAACCGCCCCCCACCACCGCGCAAGAGGCAGCCGCCGCCGCCGGAGGAC
CACCTCGTCACCTACAAGCGCCGCCGCTCCAAAGAAACACAGCCTTTGCCACTCATGGCC
AACGGCGCCAATTCTAAGAAAGACGCCAAGGCCCAACATTGGATTAGCTGGAGGGACACT
CTCCACGGCTTCCTCCAATCCCCTGCTATTAGCCAGGGTGGAGGAATTCAGACCTGCATC
CGTCATGCTCTCCAACACAATCCTTGCTTGCTCACCAATGGTGTTGTTGTTCACACTGAA
TTCAAAGGTAACCCAGCTCATTCCCAAGGAGAGGAAGCAAAAGTGCAGCACCCTAATGGT
GCTGCTGGAGGCAAGGTGGTTTCTGCAGATGCTGCTATACAAGATGCGGCTGCCGCAGCT
TCTTCCGAAGCTAACAAGGCAATGTGTAATAATGCCCTCTTCGACATTTTGGTCTCCCAG
AAATTTGCCTTGTTGTGCCATTTGCTACTTGGGACCTTCCATGTCAATAAACCTGGTGAT
GTCATCGACTTGGAAAAAATCGACGCCAAGATGAGAAATGGAGACTATGCCCACAACCCT
GCACTATTTGACGATGATATCCAGCAGATGTGGGAGAAGTTTGAGCAAGTTGGCCAAGAG
ATGACAGGTCTAGCGAGCAACCTTTCAACCATTTCACGAGTTTCATACCAAAAGCAGGCT
TCTGGATTTTCTGAAGCTGAGGTGGCTGAGCACAGAATAGAGGAAATAAGTTTGCCGGGT
GCTGTCCACGTTGTCACAAAGGAGTCGACTACCACCGTGCAGTTGGCCCCATGTGATTCT
AGTCATTCTACAATACCGAAACGAACTGTGCCACCTGGACGTGATCTGTGCCCTTGCGAT
GGTTGTGGCACCAAGGTAGATGTTGAAGAAGGCCTAATCTGTGATGAATGTGACACCATG
TACCACTTTGCATGTGTCAAGCTACTCAATCCTGATATTAAGCAAGTCCCAGCAATCTGG
CATTGTTCAACCTGCAGCTTCAAGAAAAAAGAATTGGCTGCAGATACCACGAATAATGTT
GCCCATGACTGCTTGCATGGTGGTAACTGTGTTTTGTGTGACCAGCTCGAGCTGGTGAAG
ACAGAAGAAGAAGATCCCAAGCTTCCCATAAAAATTGAATTAGCTGAAGAAAGAGAGGGG
AGCTCCGTCTCAAGCATGGGGGAAGACAATGAACCAGACCTGTCAACAACTGCCCTGTCA
AACTTGTGCAAACACTGTGGCACATGCGAAGACGATGACAAGAGATTCATGGTATGCGGA
CATCCTTACTGCGTTTACAAGTTCTATCATATCCGATGCCTGAAAACAAGCCAGCTTGCA
ATTGAGCAACAAAAGAAGCTTGGTTGCTGGTACTGCCCCTCTTGCCTCTGCAGAGGGTGC
TTCCAAGACAAGGATGATGACCAGATAGTCATGTGTGATGGCTGTGATGAAGGTTATCAC
ATATATTGCATGAGACCAGCACGCAACACTATCCCCAAAGGTAAGTGGTACTGTACATTT
TGCAAGATCCGCAGGGCAGCGGAAGGAATGCATAAGTATGAGGATTCTGTGCTGAAAATA
CATGGGAATAGTAAGCATGCTTGTAATGTGAATCAGTCGAAGGATTCTGAAGGTGATGGT
ACTGAAAAGTGA

Protein

564 aa

>Os08t0105000-02 Zinc finger, RING/FYVE/PHD-type domain containing protein.
MGSQNRPPPPRKRQPPPPEDHLVTYKRRRSKETQPLPLMANGANSKKDAKAQHWISWRDT
LHGFLQSPAISQGGGIQTCIRHALQHNPCLLTNGVVVHTEFKGNPAHSQGEEAKVQHPNG
AAGGKVVSADAAIQDAAAAASSEANKAMCNNALFDILVSQKFALLCHLLLGTFHVNKPGD
VIDLEKIDAKMRNGDYAHNPALFDDDIQQMWEKFEQVGQEMTGLASNLSTISRVSYQKQA
SGFSEAEVAEHRIEEISLPGAVHVVTKESTTTVQLAPCDSSHSTIPKRTVPPGRDLCPCD
GCGTKVDVEEGLICDECDTMYHFACVKLLNPDIKQVPAIWHCSTCSFKKKELAADTTNNV
AHDCLHGGNCVLCDQLELVKTEEEDPKLPIKIELAEEREGSSVSSMGEDNEPDLSTTALS
NLCKHCGTCEDDDKRFMVCGHPYCVYKFYHIRCLKTSQLAIEQQKKLGCWYCPSCLCRGC
FQDKDDDQIVMCDGCDEGYHIYCMRPARNTIPKGKWYCTFCKIRRAAEGMHKYEDSVLKI
HGNSKHACNVNQSKDSEGDGTEK*

5'UTR

chr08:276692..276926 (- strand) : 235 bp

CDS

chr08:276590..276691 (- strand) : 102 bp

chr08:276242..276445 (- strand) : 204 bp

chr08:275832..276152 (- strand) : 321 bp

chr08:274832..274921 (- strand) : 90 bp

chr08:274602..274646 (- strand) : 45 bp

chr08:273583..274512 (- strand) : 930 bp

3'UTR

chr08:273361..273582 (- strand) : 222 bp

FASTA

>Os08t0105000-02 class=Sequence position=chr08:273361..276926 (- strand)
TTTGTCTCCG GCTCCGCTCG CCGCCTCCAA ATCCCGCTCC TCCGCTGCTG CTCCTCTCTG CCGCGGCGAG GCGAGAGATC
CGAATCCACC GCCACCCGCG CCCACCCCGC CCGCACAAAC CCTAGTTTTT CCGGGGTTTT GCTTCCCCTC CGCAGCTCCG
CTCCGCTCCG TCCGTCGTCT CCTCCCGGCG GCTCGGCTTG CTGTCCATGC TGTAGCCGCC CCCCGCAGGT GGCTGATGGG
CTCCCAGAAC CGCCCCCCAC CACCGCGCAA GAGGCAGCCG CCGCCGCCGG AGGACCACCT CGTCACCTAC AAGCGCCGCC
GCTCCAAAGA AACACAGGTA ACCAACCAAC CAACTCCCTG CCTCTTCTTC TTCTTCTTTC TCCAGATTTC CTTTCGATTT
CTACAAGATT CGTACTCTCG CTTCTTGCCT CCTCTTACAA TCTCTCATTA CATCTACTTG TTGTGCTTTC TTTTCTTGCA
GCCTTTGCCA CTCATGGCCA ACGGCGCCAA TTCTAAGAAA GACGCCAAGG CCCAACATTG GATTAGCTGG AGGGACACTC
TCCACGGCTT CCTCCAATCC CCTGCTATTA GCCAGGGTGG AGGAATTCAG ACCTGCATCC GTCATGCTCT CCAACACAAT
CCTTGCTTGC TCACCAATGG TGTTGTTGTT CACACTGAAT TCAAAGTAAC ACACACCACC TTTGTTTGCA TCTACCCTAT
ATATATTTAT GCAATGATAA TTTTCCTAAC ACATGACTTC TTTCTCATTA CCAGGGTAAC CCAGCTCATT CCCAAGGAGA
GGAAGCAAAA GTGCAGCACC CTAATGGTGC TGCTGGAGGC AAGGTGGTTT CTGCAGATGC TGCTATACAA GATGCGGCTG
CCGCAGCTTC TTCCGAAGCT AACAAGGCAA TGTGTAATAA TGCCCTCTTC GACATTTTGG TCTCCCAGAA ATTTGCCTTG
TTGTGCCATT TGCTACTTGG GACCTTCCAT GTCAATAAAC CTGGTGATGT CATCGACTTG GAAAAAATCG ACGCCAAGAT
GAGAAATGGA GACTATGCCC ACAACCCTGC ACTATTTGAC GATGATATCC AGCAGGTAAT TGTTTCTCTA TTGCTCCCAT
GAAAGTAATT TAGCTACTGT TGTTGGAGGG AAATAATACT AGCTAGTGTT TATTCTTATC TTTTATCTAA TAAAGATGAT
GCATATTACC TGTACTTATA AGCGCCCTCT GTATGCTAAA GCTTAATGTG TTCTCCATCT ATTATTGTTC ACAACTCCGT
AAATCATAAG AGCAAAATGT TCTACGTACG GCCAGTTGAT AGAATGATGC TGATGCTCAA CTGCTTATCT GAGCTTCTTT
TGCGTTTGCT AGTTAAGATC TTCCCAAATT GTTTGAACCA TCCAAGCAAC AGACTCCTAG GGAGTTTATC ACAACTGACC
TTCTAGAACT CTGGTTGTTA GGGTTGGAAC GCTAGTCAAC TTAAATGGTA TACTAGCCCT GTTTCTACAC TATCATGTCT
TCGCAACTTT ATATGCTCTA TTTCTATCTG TCTGCTTCAT CTGCTGTCCG CAACATGCCA ACTCCCTTGC GCTTCATGGT
TGATGAAGTG GACCATGGAT AATGTGGTTG AGCTGGGGTA TGACACACAC AAAATTCTGG AACATCTCAT GCATGCTGCA
TGTGTAACCA CTCAATGCTG AGGTTTCTGT CTAAGTCAAC TAGGGTTTTA TCACTTGTTT TCTTAAATGG GCACAACACA
AAAAAGAAAA CTTTTATAAT ATTTAGTGCT AGCACATCTC AAAGACCGAA CAATTACTCT TCTATATTGA TTTCCTTATC
AGTTATCATT GATATACTTT TTTCATCTGT GAGTTTTTTT GTTTACATTA TATTGTTCAT GCTCTAAACA TAGAAGTTGT
GTAGTAACAT CTAGGAAAAA TTATACGATA CTGTTGCCTG CTGAGCCTTC CTCTTAATAC AACTCTCTAT TTGTTTATTT
TGTAGATGTG GGAGAAGTTT GAGCAAGTTG GCCAAGAGAT GACAGGTCTA GCGAGCAACC TTTCAACCAT TTCACGAGTT
TCATACCAAA AGCAGGTAAT CTGTTGCTTT ATCTTTCAAT TAATGTCTCT AGCGTCGAGA TGGTTATATT TTGACAATTT
GAGTTAAGAT AAATCTATTA CTGCACACTT GGCAACCATG CTGCAATTTG CAGGATGCTT TAGTATATTG AAATCTTTCC
TTTTATGCTG GGCATTACTA ATGGATAAAT TATTTTATAG GCTTCTGGAT TTTCTGAAGC TGAGGTGGCT GAGCACAGAA
TAGAGGTAAG TTGTCTGTTT GAGGATGTTT GCTAATCATT GTTCCACATG CACACTTAAT TAATAATGGT TTTACTAATT
GCATTCTTCA TTAGGAAATA AGTTTGCCGG GTGCTGTCCA CGTTGTCACA AAGGAGTCGA CTACCACCGT GCAGTTGGCC
CCATGTGATT CTAGTCATTC TACAATACCG AAACGAACTG TGCCACCTGG ACGTGATCTG TGCCCTTGCG ATGGTTGTGG
CACCAAGGTA GATGTTGAAG AAGGCCTAAT CTGTGATGAA TGTGACACCA TGTACCACTT TGCATGTGTC AAGCTACTCA
ATCCTGATAT TAAGCAAGTC CCAGCAATCT GGCATTGTTC AACCTGCAGC TTCAAGAAAA AAGAATTGGC TGCAGATACC
ACGAATAATG TTGCCCATGA CTGCTTGCAT GGTGGTAACT GTGTTTTGTG TGACCAGCTC GAGCTGGTGA AGACAGAAGA
AGAAGATCCC AAGCTTCCCA TAAAAATTGA ATTAGCTGAA GAAAGAGAGG GGAGCTCCGT CTCAAGCATG GGGGAAGACA
ATGAACCAGA CCTGTCAACA ACTGCCCTGT CAAACTTGTG CAAACACTGT GGCACATGCG AAGACGATGA CAAGAGATTC
ATGGTATGCG GACATCCTTA CTGCGTTTAC AAGTTCTATC ATATCCGATG CCTGAAAACA AGCCAGCTTG CAATTGAGCA
ACAAAAGAAG CTTGGTTGCT GGTACTGCCC CTCTTGCCTC TGCAGAGGGT GCTTCCAAGA CAAGGATGAT GACCAGATAG
TCATGTGTGA TGGCTGTGAT GAAGGTTATC ACATATATTG CATGAGACCA GCACGCAACA CTATCCCCAA AGGTAAGTGG
TACTGTACAT TTTGCAAGAT CCGCAGGGCA GCGGAAGGAA TGCATAAGTA TGAGGATTCT GTGCTGAAAA TACATGGGAA
TAGTAAGCAT GCTTGTAATG TGAATCAGTC GAAGGATTCT GAAGGTGATG GTACTGAAAA GTGATCATCA CAATAGCTTT
GTGGATTAGC TTCTGAGCTC GCTTGGACAA GCTCAGGAAA AGAGATTCTT TGGCCCCTTA GGAGGGCTAT ACACCGACTT
TGATACTGAA TCAGTTGTGT AGTTTATTTA ATTAACTGCC GTTGACATCT ACAGGAAGAA CTCTTACCTG GTGAAGATGG
TGTATGTAGT CTTTTAGCTG GGCGGAATGA TGTGTTGTTT ACTTGT

Locus: Os08g0105000

Loading...

Locus: Os08g0105000

Loading...