Os08t0105000-03

Locus

Os08g0105000

Description

Similar to PHD-finger family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

EHD3

CGSNL Gene Name

EARLY HEADING DATE 3

Oryzabase Gene Symbol Synonym(s)

Ehd3, OsPHD36, PHD36

Oryzabase Gene Name Synonym(s)

Early heading date3, PHD transcription factor, Plant homeo-domain finger protein 36, PHD finger protein 36

Transcript Evidence

AK102260 (DDBJ, Best hit)

Protein Evidence

F1DK84 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, PHD-type (IPR001965)

Zinc finger, FYVE/PHD-type (IPR011011)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, PHD-type, conserved site (IPR019786)

Zinc finger, PHD-finger (IPR019787)

Full-length cDNA

J033088K07 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0105000-03)

Others

Oryzabase (9301)

Transcript

1071 bp

>Os08t0105000-03 Similar to PHD-finger family protein.
GTAATCTGTTGCTTTATCTTTCAATTAATGTCTCTAGCGTCGAGATGGTTATATTTTGAC
AATTTGAGTTAAGATAAATCTATTACTGCACACTTGGCAACCATGCTGCAATTTGCAGGA
TGCTTTAGTATATTGAAATCTTTCCTTTTATGCTGGGCATTACTAATGGATAAATTATTT
TATAGGCTTCTGGATTTTCTGAAGCTGAGGTGGCTGAGCACAGAATAGAGGAAATAAGTT
TGCCGGGTGCTGTCCACGTTGTCACAAAGGAGTCGACTACCACCGTGCAGTTGGCCCCAT
GTGATTCTAGTCATTCTACAATACCGAAACGAACTGTGCCACCTGGACGTGATCTGTGCC
CTTGCGATGGTTGTGGCACCAAGGTAGATGTTGAAGAAGGCCTAATCTGTGATGAATGTG
ACACCATGTACCACTTTGCATGTGTCAAGCTACTCAATCCTGATATTAAGCAAGTCCCAG
CAATCTGGCATTGTTCAACCTGCAGCTTCAAGAAAAAAGAATTGGCTGCAGATACCACGA
ATAATGTTGCCCATGACTGCTTGCATGGTGGTAACTGTGTTTTGTGTGACCAGCTCGAGC
TGGTGAAGACAGAAGAAGAAGATCCCAAGCTTCCCATAAAAATTGAATTAGCTGAAGAAA
GAGAGGGGAGCTCCGTCTCAAGCATGGGGGAAGACAATGAACCAGACCTGTCAACAACTG
CCCTGTCAAACTTGTGCAAACACTGTGGCACATGCGAAGACGATGACAAGAGATTCATGG
TATGCGGACATCCTTACTGCGTTTACAAGTTCTATCATATCCGATGCCTGAAAACAAGCC
AGCTTGCAATTGAGCAACAAAAGAAGCTTGGTTGCTGGTACTGCCCCTCTTGCCTCTGCA
GAGGGTGCTTCCAAGACAAGGATGATGACCAGATAGTCATGTGTGATGGCTGTGATGAAG
GTTATCACATATATTGCATGAGACCAGCACGCAACACTATCCCCAAAGGTAAGTGGTACT
GTACATTTTGCAAGATCCGCAGGGCAGCGGAAGGAATGCATAAGTATGAGG

CDS

886 bp

>Os08t0105000-03 Similar to PHD-finger family protein.
GCTTCTGGATTTTCTGAAGCTGAGGTGGCTGAGCACAGAATAGAGGAAATAAGTTTGCCG
GGTGCTGTCCACGTTGTCACAAAGGAGTCGACTACCACCGTGCAGTTGGCCCCATGTGAT
TCTAGTCATTCTACAATACCGAAACGAACTGTGCCACCTGGACGTGATCTGTGCCCTTGC
GATGGTTGTGGCACCAAGGTAGATGTTGAAGAAGGCCTAATCTGTGATGAATGTGACACC
ATGTACCACTTTGCATGTGTCAAGCTACTCAATCCTGATATTAAGCAAGTCCCAGCAATC
TGGCATTGTTCAACCTGCAGCTTCAAGAAAAAAGAATTGGCTGCAGATACCACGAATAAT
GTTGCCCATGACTGCTTGCATGGTGGTAACTGTGTTTTGTGTGACCAGCTCGAGCTGGTG
AAGACAGAAGAAGAAGATCCCAAGCTTCCCATAAAAATTGAATTAGCTGAAGAAAGAGAG
GGGAGCTCCGTCTCAAGCATGGGGGAAGACAATGAACCAGACCTGTCAACAACTGCCCTG
TCAAACTTGTGCAAACACTGTGGCACATGCGAAGACGATGACAAGAGATTCATGGTATGC
GGACATCCTTACTGCGTTTACAAGTTCTATCATATCCGATGCCTGAAAACAAGCCAGCTT
GCAATTGAGCAACAAAAGAAGCTTGGTTGCTGGTACTGCCCCTCTTGCCTCTGCAGAGGG
TGCTTCCAAGACAAGGATGATGACCAGATAGTCATGTGTGATGGCTGTGATGAAGGTTAT
CACATATATTGCATGAGACCAGCACGCAACACTATCCCCAAAGGTAAGTGGTACTGTACA
TTTTGCAAGATCCGCAGGGCAGCGGAAGGAATGCATAAGTATGAGG

Protein

295 aa

>Os08t0105000-03 Similar to PHD-finger family protein.
ASGFSEAEVAEHRIEEISLPGAVHVVTKESTTTVQLAPCDSSHSTIPKRTVPPGRDLCPC
DGCGTKVDVEEGLICDECDTMYHFACVKLLNPDIKQVPAIWHCSTCSFKKKELAADTTNN
VAHDCLHGGNCVLCDQLELVKTEEEDPKLPIKIELAEEREGSSVSSMGEDNEPDLSTTAL
SNLCKHCGTCEDDDKRFMVCGHPYCVYKFYHIRCLKTSQLAIEQQKKLGCWYCPSCLCRG
CFQDKDDDQIVMCDGCDEGYHIYCMRPARNTIPKGKWYCTFCKIRRAAEGMHKYE

5'UTR

chr08:274647..274831 (- strand) : 185 bp

CDS

chr08:274602..274646 (- strand) : 45 bp

chr08:273672..274512 (- strand) : 841 bp

FASTA

>Os08t0105000-03 class=Sequence position=chr08:273672..274831 (- strand)
GTAATCTGTT GCTTTATCTT TCAATTAATG TCTCTAGCGT CGAGATGGTT ATATTTTGAC AATTTGAGTT AAGATAAATC
TATTACTGCA CACTTGGCAA CCATGCTGCA ATTTGCAGGA TGCTTTAGTA TATTGAAATC TTTCCTTTTA TGCTGGGCAT
TACTAATGGA TAAATTATTT TATAGGCTTC TGGATTTTCT GAAGCTGAGG TGGCTGAGCA CAGAATAGAG GTAAGTTGTC
TGTTTGAGGA TGTTTGCTAA TCATTGTTCC ACATGCACAC TTAATTAATA ATGGTTTTAC TAATTGCATT CTTCATTAGG
AAATAAGTTT GCCGGGTGCT GTCCACGTTG TCACAAAGGA GTCGACTACC ACCGTGCAGT TGGCCCCATG TGATTCTAGT
CATTCTACAA TACCGAAACG AACTGTGCCA CCTGGACGTG ATCTGTGCCC TTGCGATGGT TGTGGCACCA AGGTAGATGT
TGAAGAAGGC CTAATCTGTG ATGAATGTGA CACCATGTAC CACTTTGCAT GTGTCAAGCT ACTCAATCCT GATATTAAGC
AAGTCCCAGC AATCTGGCAT TGTTCAACCT GCAGCTTCAA GAAAAAAGAA TTGGCTGCAG ATACCACGAA TAATGTTGCC
CATGACTGCT TGCATGGTGG TAACTGTGTT TTGTGTGACC AGCTCGAGCT GGTGAAGACA GAAGAAGAAG ATCCCAAGCT
TCCCATAAAA ATTGAATTAG CTGAAGAAAG AGAGGGGAGC TCCGTCTCAA GCATGGGGGA AGACAATGAA CCAGACCTGT
CAACAACTGC CCTGTCAAAC TTGTGCAAAC ACTGTGGCAC ATGCGAAGAC GATGACAAGA GATTCATGGT ATGCGGACAT
CCTTACTGCG TTTACAAGTT CTATCATATC CGATGCCTGA AAACAAGCCA GCTTGCAATT GAGCAACAAA AGAAGCTTGG
TTGCTGGTAC TGCCCCTCTT GCCTCTGCAG AGGGTGCTTC CAAGACAAGG ATGATGACCA GATAGTCATG TGTGATGGCT
GTGATGAAGG TTATCACATA TATTGCATGA GACCAGCACG CAACACTATC CCCAAAGGTA AGTGGTACTG TACATTTTGC
AAGATCCGCA GGGCAGCGGA AGGAATGCAT AAGTATGAGG 

Locus: Os08g0105000

Loading...

Locus: Os08g0105000

Loading...