Os08t0109400-01

Locus

Os08g0109400

Description

AUX/IAA protein family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA25

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA25

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 25

Transcript Evidence

AK068232 (DDBJ, Best hit)

Protein Evidence

P0C128 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

J013149D08 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0109400-01)

RiceXPro (AK068232)

Others

Oryzabase (10912)

KEGG (Os08t0109400-01)

Transcript

3100 bp

>Os08t0109400-01 AUX/IAA protein family protein.
GGGTCTCTGGGTTCTCTGCTCCCTAACAGAAAAGAAAGAAAGAAAGAAGCTTTCACCACA
AAAACCCAACCCACCGGTGGACAAGAGGAATTCGACTATTCCAGATAGGGCGACATGGAC
TGCGAGATGAGGCGACTCTAGTGCCAGTCACTCCGGTGGCCCATTTTTTCTTCCTTTTTC
AGGGGAAAAAAAGGAAGGAATTTGGGTAGATCAATCAATGGAGCAGAGAAATTCGATGTT
TGTTTGTTTGTTTGTTCAATAGAGGAGAGCAATTCTTGGTCATGTATGCATCTTGCCCAC
AGTGGAAGGAGTGAGTGTGATTTGGAAGACGCAGGTAGAGGGTGTGCCTTCCAGGTGTTC
GATCATTTGCCTCAAAGAATCCATATCCTCTTTTGTGCTACTGTCCAGATGATGTTCAGG
AATAATAACAGAAAGAAAACTCCAAGAGTGCTGACAAGTGACAACCAGGAGATGCAGACA
TGCAGTTCCTCGATGAATGATTCCTGATGTCCTTGTACAGTTGTCCTCAGCCATTTGGAA
CAATGGGGATTCTTTGCCGGTATGCTCTATCATCAGGAAGGAACATTTCTGTGAGAAGAG
CTGCTACAAGATATGTATGAGTTAGTTAAAAGAAAAAAAAAGATACTAGAAACCAAAGCT
ACAGAAGAAGCAATTAGAGGGGCCTAACTCATCATTGTGAGCCTGAACATAATGCAGTGT
TAAAGATAAGTCAACAAAGCTTCTTGTCTGAGTCCACTTATGTTCTGAAAATGGCATGGC
ATGCAGATCAGACAGGACATATTGCTGCAGCACCTATTAATCTGCCTACTCCTTAAGCAC
TAAGAAAGAAATATATACTAAAGTGTTTATTCCAGTTATTTTTAGGTGGGACAAGATACT
CCTGAGTAAACAACCCATCATTACTTTGTGATACAATTAGGCAGGCCAATCATGGAGCTA
AATGGAATAGAACTTGCTTAGGGATAGCTTATAGGTTTTCTCTTTGCACCTTAATAGATC
TTCACATCCTTGTTAAGAGACGTGCCTTTAAATGATTAAATTAAGGAAGTACATGCAAGT
GGTAAAGCTTTTCGGGAATACGCAAGGAGCGCATTTTTTCCATTAAGAGAAATAAAAGTT
ATTTACATTTGAAAGAGAAAAACAGCACGGGACTGATACAGGACAATAACAGACAATCCT
AGGTCTATCTCTCGCGCAAGTGGTAAAGCTGATAGGTGAAAAGATGAGTGTCTTTCTAAT
AAAGCTTCTCACCTTACATGTAAAGAACAGATACTAAATATTATGTTAACATGGAACGTA
AGGAGCTGTCATTGTACAAAGAGGATCAACAGCAAAGTAATATTTCTTTTCTAGTATATA
ATAAAGTTTGTACAATCCAATAGATTCTTAGGAGCTATTTTTTCTTCAAGTGAGGATTTT
GATGCATATATGTAGGCATCATGGAATCATATGCCTTGCTTCCACATTAACTTAAGAGCA
GTCTGAATAAGCATAGGTCATCCAACTTGTCAGGTTTAATCGATTTTGGTTAGAAAAGCA
AAGATTATCTGTACTAATGCAGAGGGACCAAATGGCCATCTTGAGTTACTTTACCAAGGT
CTCATGTGGGCAGAAAAGGCAAAGCTTATGGTAAAATGGGCAATGATGAGAAATGTGCTC
TCCAGTGTGTCACCACAAGCACTAAGACACTATCTAATGGTTGGAAAACGTCACAGGAAC
CATAGAAGAAGATCCCAGGTTCATCATAATAGAAGCTGAACAAAGAAAGCAGAGCAGGGG
AGCATGCTTACTTTCAGGAAAAGATTGAAGTGGACTGAAGTTTCAACTGGAGCTCCAATA
GACACCACATTCCCCACCAAGACACAAGTTTGGGAGAAGAGAATCCATGAAGAGCTCTTC
AGTTGCACCAAGGCTGAAACAGGAGAGACAAGATGACTGTAAGTTTCAGGAAGGTGATGT
GAACAGCCTTGAGCTTCGGCTTGGCATATCTTCCGACAATGACCAGATCAGTGGTGGTGG
TGCTGCTAGTCCATGGCTTGGTGTGGGAGTGCACCCTTGGAGCCTGGCTGCAAGGCAAGG
GAAGGCAGCCTTGGAGCAAGCTCACCAGAGGCCTAATGAATGTGCTGTCCAAAGAGAAAA
CCGCGCGGCTTCATCAGCTCAGCTGGTGGGATGGCCACCGGTGCGCGCATTCCGCAAGAA
CCTGTCCACCCCAAAACCTGCAGATGCAGATGACCTGATGAACAAGGTGAAGCTCTGCTC
TGATGAGGGCCATGGCTCCAGATGTGCAGCCCAAGAGAGGAGGTCATCATCAACCATGTT
TGTGAAGGTGAACCTGGAGGGCTATGCTGTCGGAAGGAAGATCGACCTGAAGGCGCACCG
CAGCTATGACTCTCTGTCCCAGGCTCTGCAGAGCATGTTCCATGGCTTCTTGTCAGATGG
CATTGCAACTAGAGACAATGAGCTGCAGCAGATGGAGGAGGGCAGCAAGAAGAGGTATGT
TCTTGTGTATGAGGATAATGAGGGAGACCGCATGCTCGTCGGCGACGTCCCATGGGAGCT
GTTCATTGCTTCAGTGAAGAGGCTCTACATTGCTCAGGATCCTAGAGTTCATGCGAAGCT
ACGATAATAGCAATGTTGCAAGCTGATCCTGAAAGCCTGGACCGCAACCGAGGATGAGAA
AGATCGATTGCTGCTTTTATCATGAGCAGATGCAAGGAAATATATATATGGCATAGGATG
ACAGGAGCATCATATTCAAAGAGACGAAGCAGCAATATGTGCTAGTGTTTAGCTGACATG
CTGTCCCTGTTCGCTTAATTAGTAGAATGATTAAATTTGCCTTGGTTGTGCTTGAGGGAG
CTAGTGCTCATACTAGACTATACTAATTCCCTAAAAAAAAACAACAAAAAAAGTAGACTT
CTAGTGCGGTTAATGTAGAAAGTTTTGGTTGTGTATATATTTTTTGACCTGTTGTACTAT
AATTGAACTGATGGTGCATTAGCTAGTGCTTGTTAATTAGCTTGTACTATGTGTGTGGGT
GGATGTAAATGACACTGGGTGCAATAAACTAGTCTTGGGT

CDS

741 bp

>Os08t0109400-01 AUX/IAA protein family protein.
ATGAAGAGCTCTTCAGTTGCACCAAGGCTGAAACAGGAGAGACAAGATGACTGTAAGTTT
CAGGAAGGTGATGTGAACAGCCTTGAGCTTCGGCTTGGCATATCTTCCGACAATGACCAG
ATCAGTGGTGGTGGTGCTGCTAGTCCATGGCTTGGTGTGGGAGTGCACCCTTGGAGCCTG
GCTGCAAGGCAAGGGAAGGCAGCCTTGGAGCAAGCTCACCAGAGGCCTAATGAATGTGCT
GTCCAAAGAGAAAACCGCGCGGCTTCATCAGCTCAGCTGGTGGGATGGCCACCGGTGCGC
GCATTCCGCAAGAACCTGTCCACCCCAAAACCTGCAGATGCAGATGACCTGATGAACAAG
GTGAAGCTCTGCTCTGATGAGGGCCATGGCTCCAGATGTGCAGCCCAAGAGAGGAGGTCA
TCATCAACCATGTTTGTGAAGGTGAACCTGGAGGGCTATGCTGTCGGAAGGAAGATCGAC
CTGAAGGCGCACCGCAGCTATGACTCTCTGTCCCAGGCTCTGCAGAGCATGTTCCATGGC
TTCTTGTCAGATGGCATTGCAACTAGAGACAATGAGCTGCAGCAGATGGAGGAGGGCAGC
AAGAAGAGGTATGTTCTTGTGTATGAGGATAATGAGGGAGACCGCATGCTCGTCGGCGAC
GTCCCATGGGAGCTGTTCATTGCTTCAGTGAAGAGGCTCTACATTGCTCAGGATCCTAGA
GTTCATGCGAAGCTACGATAA

Protein

247 aa

>Os08t0109400-01 AUX/IAA protein family protein.
MKSSSVAPRLKQERQDDCKFQEGDVNSLELRLGISSDNDQISGGGAASPWLGVGVHPWSL
AARQGKAALEQAHQRPNECAVQRENRAASSAQLVGWPPVRAFRKNLSTPKPADADDLMNK
VKLCSDEGHGSRCAAQERRSSSTMFVKVNLEGYAVGRKIDLKAHRSYDSLSQALQSMFHG
FLSDGIATRDNELQQMEEGSKKRYVLVYEDNEGDRMLVGDVPWELFIASVKRLYIAQDPR
VHAKLR*

5'UTR

chr08:468151..468569 (+ strand) : 419 bp

chr08:468680..468881 (+ strand) : 202 bp

chr08:468960..469982 (+ strand) : 1023 bp

chr08:470092..470183 (+ strand) : 92 bp

chr08:470459..470500 (+ strand) : 42 bp

chr08:470664..470773 (+ strand) : 110 bp

chr08:471242..471259 (+ strand) : 18 bp

CDS

chr08:471260..471507 (+ strand) : 248 bp

chr08:472245..472546 (+ strand) : 302 bp

chr08:472629..472749 (+ strand) : 121 bp

chr08:472871..472940 (+ strand) : 70 bp

3'UTR

chr08:472941..472948 (+ strand) : 8 bp

chr08:473066..473510 (+ strand) : 445 bp

FASTA

>Os08t0109400-01 class=Sequence position=chr08:468151..473510 (+ strand)
GGGTCTCTGG GTTCTCTGCT CCCTAACAGA AAAGAAAGAA AGAAAGAAGC TTTCACCACA AAAACCCAAC CCACCGGTGG
ACAAGAGGAA TTCGACTATT CCAGATAGGG CGACATGGAC TGCGAGATGA GGCGACTCTA GTGCCAGTCA CTCCGGTGGC
CCATTTTTTC TTCCTTTTTC AGGGGAAAAA AAGGAAGGAA TTTGGGTAGA TCAATCAATG GAGCAGAGAA ATTCGATGTT
TGTTTGTTTG TTTGTTCAAT AGAGGAGAGC AATTCTTGGT CATGTATGCA TCTTGCCCAC AGTGGAAGGA GTGAGTGTGA
TTTGGAAGAC GCAGGTAGAG GGTGTGCCTT CCAGGTGTTC GATCATTTGC CTCAAAGAAT CCATATCCTC TTTTGTGCTA
CTGTCCAGAT GATGTTCAGG TGATGGTTTC GGATGCCAAC ATGACTTCCT TCTTGTGTAT GTCGGAAGAG AAGTGAGGAA
CCTGAGTTCT TCTTACCACC TTTAATTGTT CGACTTGATC GGCATGCAGG AATAATAACA GAAAGAAAAC TCCAAGAGTG
CTGACAAGTG ACAACCAGGA GATGCAGACA TGCAGTTCCT CGATGAATGA TTCCTGATGT CCTTGTACAG TTGTCCTCAG
CCATTTGGAA CAATGGGGAT TCTTTGCCGG TATGCTCTAT CATCAGGAAG GAACATTTCT GTGAGAAGAG CTGCTACAAG
ATATGTATGA GGTATGAGGT ATCTATCTCC TGCCAATTAC TCCAAGCTTT TCCATGTTCC AATAATTGCT TGTTTCTGCG
TTCCTGCAGT TAGTTAAAAG AAAAAAAAAG ATACTAGAAA CCAAAGCTAC AGAAGAAGCA ATTAGAGGGG CCTAACTCAT
CATTGTGAGC CTGAACATAA TGCAGTGTTA AAGATAAGTC AACAAAGCTT CTTGTCTGAG TCCACTTATG TTCTGAAAAT
GGCATGGCAT GCAGATCAGA CAGGACATAT TGCTGCAGCA CCTATTAATC TGCCTACTCC TTAAGCACTA AGAAAGAAAT
ATATACTAAA GTGTTTATTC CAGTTATTTT TAGGTGGGAC AAGATACTCC TGAGTAAACA ACCCATCATT ACTTTGTGAT
ACAATTAGGC AGGCCAATCA TGGAGCTAAA TGGAATAGAA CTTGCTTAGG GATAGCTTAT AGGTTTTCTC TTTGCACCTT
AATAGATCTT CACATCCTTG TTAAGAGACG TGCCTTTAAA TGATTAAATT AAGGAAGTAC ATGCAAGTGG TAAAGCTTTT
CGGGAATACG CAAGGAGCGC ATTTTTTCCA TTAAGAGAAA TAAAAGTTAT TTACATTTGA AAGAGAAAAA CAGCACGGGA
CTGATACAGG ACAATAACAG ACAATCCTAG GTCTATCTCT CGCGCAAGTG GTAAAGCTGA TAGGTGAAAA GATGAGTGTC
TTTCTAATAA AGCTTCTCAC CTTACATGTA AAGAACAGAT ACTAAATATT ATGTTAACAT GGAACGTAAG GAGCTGTCAT
TGTACAAAGA GGATCAACAG CAAAGTAATA TTTCTTTTCT AGTATATAAT AAAGTTTGTA CAATCCAATA GATTCTTAGG
AGCTATTTTT TCTTCAAGTG AGGATTTTGA TGCATATATG TAGGCATCAT GGAATCATAT GCCTTGCTTC CACATTAACT
TAAGAGCAGT CTGAATAAGC ATAGGTCATC CAACTTGTCA GGTTTAATCG ATTTTGGTTA GAAAAGCAAA GATTATCTGT
ACTAATGCAG AGGGACCAAA TGGCCATCTT GAGTTACTTT ACCAAGGTCT CATGTGGGCA GAAAAGGCAA AGGTACATTT
GGTTTAGTGA AAAGCACTGA TGTTGTGGAC CTCAATAAAA CTCTAATATT CTTTTACTAA GTTTATTTCT TCTTGTTTGA
AACTTAACAA TTTTTCCTCA GCTTATGGTA AAATGGGCAA TGATGAGAAA TGTGCTCTCC AGTGTGTCAC CACAAGCACT
AAGACACTAT CTAATGGTTG GAAAACGTCA CAGGTAAAAT CTAACTCTTT CTTCTCTGAA TCAGAACAAT AACTTGCTTG
ACTAATACGC TGATAATAAT TCAAAAATAG CTTGGTGAGT ATGATATGTT AAGGACTAGT GCATGCTTCG TTTGCAGTCA
GATAACCACT TAGTACATGG TAACATCAAC GTCTATGTCA ATACCTACCG TAACTCGGTA GCTGAAAGAA TTACCATCTA
ATTTTAAGAT TTTTTATTTC TGGTGGGAGT ACATGCAGCA CTATAAATCA CTAAATTTTA ATTGGCAGGA ACCATAGAAG
AAGATCCCAG GTTCATCATA ATAGAAGCTG GTACATGTTT CATGGACCAC ATTTAAACTG GAAACACACA GCTCCTAAGT
TTTTAGTCTC AGTATCTCCT TTTAAATTTT GCATGATGCA AGAGGGCATC TTGAGAAATA TGTTCAAGTT CAGCATAACT
GTTACCCAAA AGTGATCTGC CAATTTTCTG CAGAACAAAG AAAGCAGAGC AGGGGAGCAT GCTTACTTTC AGGAAAAGAT
TGAAGTGGAC TGAAGTTTCA ACTGGAGCTC CAATAGACAC CACATTCCCC ACCAAGACAC AAGGTCAGAC AAAACCACAC
AGAAAATCTT GCAAACGACA AGACATTGCC ATCCACATGT CCACTTGTAT CTTGTTGATT TTGGTGCTCT TATACTCTTC
AGAGTATAAT TTTATCAAAC TAGTAGACGC TGTAACACAT TCATACTTCA AAACTTTTTA CTGTTCCTCA ACTTAATTCC
ACACATTTCA AATTTACATG GATTCAGTGT GATTCTGATT TTTTTTCACC AATATGTGTA GATCAAATTT TGCACTTTTA
CAGGCCTATC ATTATTTCAT ACTTTTAGTT AGACCCCACT GGTGCACTTT AGTACTCACC AAAGGTCTCC CCACAAAGAC
ACCTGCCTTT CTCATCATCT GCCTCCTCAG TTCCCTTTAA TTATTCCCTT GCAACTACCT CAACACCATA AAGACCTACA
AAGCCCTTCT CTCACACACT CTCACACAAT TGCTACATAC AAACACTACA GTTTGGGAGA AGAGAATCCA TGAAGAGCTC
TTCAGTTGCA CCAAGGCTGA AACAGGAGAG ACAAGATGAC TGTAAGTTTC AGGAAGGTGA TGTGAACAGC CTTGAGCTTC
GGCTTGGCAT ATCTTCCGAC AATGACCAGA TCAGTGGTGG TGGTGCTGCT AGTCCATGGC TTGGTGTGGG AGTGCACCCT
TGGAGCCTGG CTGCAAGGCA AGGGAAGGCA GCCTTGGAGC AAGCTCACCA GAGGCCTAAT GAATGTGCTG TCCAAAGGTT
TGGTTACCAC TTACAATCTA ATAGCTTTTT CCTAGAAATT TCTGCCATGA AAACATTGTG TTGAATTAGG TTGAGATGAA
ATCTACTCAT TGTTCTGAAA ATACAACACA ACCTTCATAT CTCTTTTGAA TGTAAGAGAT TGCTCTGGTT CAGTCAGGGG
TATATTTAAG TTGCTCCTTG TTTTGATGTG ATCACAACTT GTTCTGGGAG ATCATAAAAA CGCATGACAG CAAACAAGAG
AACAAAATAC TGCCTGAATG TTCAAAGACA GAATTCGCGC GTAAAGGGAG GAGAAGGAGA AAAAAAGTTA AACAGAAATA
TAAAAGGGAA GCACAAAGAT GATCTTTATT TTTTAAAAAA AGAAAATAAA AGGAAAAAGA AACAGAAAGG AAGCAGAAGG
GGCCATTAGA GCCATCATCA TGCAGAAGTA AGAACCTCCA TAACTTTAAA GGTGGATGGA GAAAATGACC TTCCCATTAG
TTTCAGCCTG CAGAGTTGCT GTCATGAAAT TCTCATCCAT TATCTAAAAG ATTGAAATTC TCATCAGTAT GGAATCTTTG
CAGTTAGGGA GGAACAATAA CAAATGGTTC ATGGTAGCAC CTATCATGTA TCAAAGTTTA TTTCTTGTTT GCTACCATGA
ACAATTTACT TAATTTATTT ACTATCAATG TTTCCAAAAA GGTTTAGCCT CATCATCTCA CCAAATTTAC TTTATTTACT
AACAAAATGT TCAGAGAAAA CCGCGCGGCT TCATCAGCTC AGCTGGTGGG ATGGCCACCG GTGCGCGCAT TCCGCAAGAA
CCTGTCCACC CCAAAACCTG CAGATGCAGA TGACCTGATG AACAAGGTGA AGCTCTGCTC TGATGAGGGC CATGGCTCCA
GATGTGCAGC CCAAGAGAGG AGGTCATCAT CAACCATGTT TGTGAAGGTG AACCTGGAGG GCTATGCTGT CGGAAGGAAG
ATCGACCTGA AGGCGCACCG CAGCTATGAC TCTCTGTCCC AGGCTCTGCA GAGCATGTTC CATGGCTTCT TGTCAGGTCA
AGACCTTTGA GTGCTGGATT GGGAGTGAGC TCCATAGTAT TTCTTGCTCA GGTGACTGAT CTTGATGCTT GGTTTCAGAT
GGCATTGCAA CTAGAGACAA TGAGCTGCAG CAGATGGAGG AGGGCAGCAA GAAGAGGTAT GTTCTTGTGT ATGAGGATAA
TGAGGGAGAC CGCATGCTCG TCGGCGACGT CCCATGGGAG TACGTTTGTT TGCTTTGAGA AACCTCTCAT TTCTGACATT
TTTTTCCTTT TATCCAACGA AGAAGATGAC ATGAAGAGCT GAAAACTGAT TGATCGATCT TGCAAATTTT ATATATGCAG
GCTGTTCATT GCTTCAGTGA AGAGGCTCTA CATTGCTCAG GATCCTAGAG TTCATGCGAA GCTACGATAA TAGCAATGGT
GTGTACCCAG GAATGAGCCA CACCTCCACT GCAAGAACAT GCAGTTAAAT AGTTAATATG TTTGGAGCAG AACATGTACT
AATAGGACAC AAAAATTAAC TGCTTGTTTT TGCAGTTGCA AGCTGATCCT GAAAGCCTGG ACCGCAACCG AGGATGAGAA
AGATCGATTG CTGCTTTTAT CATGAGCAGA TGCAAGGAAA TATATATATG GCATAGGATG ACAGGAGCAT CATATTCAAA
GAGACGAAGC AGCAATATGT GCTAGTGTTT AGCTGACATG CTGTCCCTGT TCGCTTAATT AGTAGAATGA TTAAATTTGC
CTTGGTTGTG CTTGAGGGAG CTAGTGCTCA TACTAGACTA TACTAATTCC CTAAAAAAAA ACAACAAAAA AAGTAGACTT
CTAGTGCGGT TAATGTAGAA AGTTTTGGTT GTGTATATAT TTTTTGACCT GTTGTACTAT AATTGAACTG ATGGTGCATT
AGCTAGTGCT TGTTAATTAG CTTGTACTAT GTGTGTGGGT GGATGTAAAT GACACTGGGT GCAATAAACT AGTCTTGGGT

Locus: Os08g0109400

Loading...

Locus: Os08g0109400

Loading...