Os08t0109800-01

Locus

Os08g0109800

Description

Regulator of chromosome condensation/beta-lactamase-inhibitor protein II domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCRR2

Oryzabase Gene Name Synonym(s)

CRINKLY4-RELATED protein 2

Transcript Evidence

AK109954 (DDBJ, Best hit)

Protein Evidence

A3BNY2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, active site (IPR008271)

Regulator of chromosome condensation/beta-lactamase-inhibitor protein II (IPR009091)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

002-159-A10 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0109800-01)

RiceXPro (AK109954)

Others

Oryzabase (10378)

KEGG (Os08t0109800-01)

Transcript

3091 bp

>Os08t0109800-01 Regulator of chromosome condensation/beta-lactamase-inhibitor protein II domain containing protein.
TTTCTTCCATTTCCAAAGCCAAGAAAGAAAGGGAGGAGTAAGTCTCCCCCATGTCGTCTT
CTCCTCGCTCCCAATGCCAATGTCTCGCCATGGCGCCCTTGCTCTGACCACCTCCTTCCT
CCTCGCGGCCGTCGCCGTCTTCCTTCCCGGGCACGCGGCGGCGCGGCAGTTCTCCACCGT
CGCCATCTCCAACTCCCCCGACGCGACGGTCGTGTGCGCGCTCGTCCGCCCCAAGGACGT
GCCCGATGATGTCCCCGGCGCCAAGCTGCGGTGCACCTCCATGCCCACCGGCGAGGTCAT
GTCCTACCCCTCCGCGGACGTCCCCTACAACGCCATCGCCGCCGGCACCGACTTCCTGTG
CGGCCTCATGGCGCCCAACGGCGGCCACGCCGCCATGCGCTGGTGGTCCTTCTCCGACGA
GGCCGCCGCCAACCGCTCCCGCCCCGTCGGCCGCCGCCTCTACTGGGGCCCTTCCCTCCG
CGCCCTCTCCGCCGGTGGCCCTCACGTCTGCGGCCTCTCCGACGCCCACGACCCGACGTG
CTGGGAGTGGCCGGGGTTGAGCTTGCCCAAGGGCCTCGACTTCTCCCGCATCGCCCTCGG
CCGCGACTTCCTCTGCGGCGTCGTCAAGGGCAACGCCTCCGCCATGACCTGCTTCGGCGG
CGGCATGGCGCCGCCCGCGTTCGCCGGGGCTGCTTCCATCGTGGCGGTCGCCGCCGGCCA
CCGCCACGCCTGCGCCGTCGACGACGACGGCGGCATGTCGTGCTGGGGCGAAGGGTACCC
GGACATGCGCCCCGGCGACCTCCCCGCCGACATGAAGTCCATGGCGCTGGGGCGGAACAC
GACGTGCATCCTCGACGGCGACGACATGGTGCGGTGCTGGGGCGTGGAGGTGCCCGAGGA
GTACAGGCGCGCGTCGTTCGTGTCCATCGAGGCCGACGGCGACACCGTCTGCGGCGTCCT
CACCACCAACTTCTCCGTCGTGTGCTGGGGCAACGAGAGGTTCCATGGGAGGCACCTCAT
CTTCAACGACACCATGCCCGGCGCGTGCGCCACCGTCGGCAACTGCTCCTCCAGCTGCGG
CTTCGTCCCCGGCTCCGCCGCGCTCTGCGGCAACGGCGGCGGCGAGGGCGGCGAGCAGCT
CGTCGTGTGCCAGCCCTGCAAGCTGCCGCTCAACGCGTCCAGGCTCGTCGTCGGGAATGG
GACCAGCAAGAATGCGGCGGCGCCGACTGATTCCGGGAAGAACAGGAAGGCCGTCAAGGT
CGCGGTCACCGCGGCCTGCGTCGGCGTCGCGGCGCTCGTGGTGGCTGGGCTGGTGTTGTA
CCTCGCCGTCGTGAGGAAGCGTGGCGGGAAGAAGAACGCCACCGTGCAGCTCGGCGAGTC
GTCGACGCTGACCCTCTGCCGCGACTTGGAGGGGGCCGTGATCATGCCGGCGCCGGAGGC
ATCGCCGCCGCCGCCGCCGCTCGGGTGCGAAGAGTTCACGGTGAAGGAGCTCTCGCGGCT
GACGAACGGGTTCGCCGAGGAGAGGAAGATCGGGAGCGGCAGCTTCGGGTCGGTGTATCG
CGCGAAGCTCCCCGACGGGCGCGAGGTCGCCATCAAGCGCGCGGAGCGTCCGCGCGCGGC
GTCGGGCGGCGGGCGTCGCCGGCGCCGCCGGTACGACGCGGAGCGCGCGTTCCGGGCGGA
GCTCCGGCTGCTGTCCCGCGTGAACCACCGCAAcctggtgcagctgctgggcttctgcga
ggagcgcggcgagcgcatcctggtgttcgagttcatgccgcacggcgcgctgcacgacca
cctccacggccgCGTCGACGGCCACTCCCCGCTGTTCGCGTCGTGGGaggcgcggctccg
ggtggcgctcgacgcggcgcgcggcgtcgagtacctgcattgctacgccgtgccgccgat
catccaccgcgacatcaagccgtccaacatcctcctcgacggcgagtggaccgccaaggt
gtcggacttcgggctgtcgctggcatcatcatcgtcgtcgtcggcgaccgcgacaccacc
ggcggcgtgctcgacgtcgtcgacggcggggacggtggggtacatcgacccggagtacta
ccggctgcaggagctgacgcagcggagcgacgtgtacagcttcggCGTGGTGCTCCTCGA
GCTGGTGACCGggaggaaggcgatccaccggcaggagggcgggagcgggtcgccgcggaa
cgtgatcgagttcgccgtgccggcggtggaggcgggcggcgtcgggaggatcatggacgg
gcgcgtgccggcgccgcgcgggaacgaggcggaggcggtgtcgcgcgtggcgaggatcgc
gagcgagtgcgtgcggccgcgggggcgcgcgcggccggtgatgtcggaggtggtcgccga
gctggagtgggcggtcACGCTCTGCGAGGAGTCCGTAGACCGGAGCTCCGCCGCCGCCCA
GCAGCAGAACAGCTCGCGGCACGGCGGCTCCGACGTGTCGCGGTCGGAGTCCGACGACCC
CAGCCCCTTCCACACGAGGGAGTTCGCCGGCGTCGGACATGGCAGGTCAAACTCAGCAAT
GTAAAAAAAAAAAACAAACGAGTTTTATTTTTTTATCCTTTTTTTATTTATTTTCTTTGT
TTTGTTTTAATTAGTTTCCACGGTTGCTGGAATAGGATGAATTAGTTGCTGTGCATAAAC
ATTTTTCAAAGAGGAAAAAAAAGATACTGAGAGGGAGTATTCATTTTGATGTTGATTGTT
ACTTGAATTAGTCTAGGAGAGTTTTTGATTGCTTTTGCTCTGTGAACAAAATTCATAAGA
GTTTGACAAAATCTAACATGTACGTTGTATATCAAGATTTATTGACACAACATAATAATA
TAATAATAATACTAGTTGGAGTAGTGGGTGGTTTGTAAGTACAATCTTGTTTTTTCTTCT
GTTTTGATTTGTTAGCTTAGAAATTTTCGGAGGGTTGGTAGGTTAGATTAGACAAAATTA
TTAATTTGTGGCCTTGTGAGAGTGTGGAGATGCAACAACTGTACTTCTTCCAACAAACTG
CTTTTATTATATAATGTAATACTTGGAGTGC

CDS

2511 bp

>Os08t0109800-01 Regulator of chromosome condensation/beta-lactamase-inhibitor protein II domain containing protein.
ATGCCAATGTCTCGCCATGGCGCCCTTGCTCTGACCACCTCCTTCCTCCTCGCGGCCGTC
GCCGTCTTCCTTCCCGGGCACGCGGCGGCGCGGCAGTTCTCCACCGTCGCCATCTCCAAC
TCCCCCGACGCGACGGTCGTGTGCGCGCTCGTCCGCCCCAAGGACGTGCCCGATGATGTC
CCCGGCGCCAAGCTGCGGTGCACCTCCATGCCCACCGGCGAGGTCATGTCCTACCCCTCC
GCGGACGTCCCCTACAACGCCATCGCCGCCGGCACCGACTTCCTGTGCGGCCTCATGGCG
CCCAACGGCGGCCACGCCGCCATGCGCTGGTGGTCCTTCTCCGACGAGGCCGCCGCCAAC
CGCTCCCGCCCCGTCGGCCGCCGCCTCTACTGGGGCCCTTCCCTCCGCGCCCTCTCCGCC
GGTGGCCCTCACGTCTGCGGCCTCTCCGACGCCCACGACCCGACGTGCTGGGAGTGGCCG
GGGTTGAGCTTGCCCAAGGGCCTCGACTTCTCCCGCATCGCCCTCGGCCGCGACTTCCTC
TGCGGCGTCGTCAAGGGCAACGCCTCCGCCATGACCTGCTTCGGCGGCGGCATGGCGCCG
CCCGCGTTCGCCGGGGCTGCTTCCATCGTGGCGGTCGCCGCCGGCCACCGCCACGCCTGC
GCCGTCGACGACGACGGCGGCATGTCGTGCTGGGGCGAAGGGTACCCGGACATGCGCCCC
GGCGACCTCCCCGCCGACATGAAGTCCATGGCGCTGGGGCGGAACACGACGTGCATCCTC
GACGGCGACGACATGGTGCGGTGCTGGGGCGTGGAGGTGCCCGAGGAGTACAGGCGCGCG
TCGTTCGTGTCCATCGAGGCCGACGGCGACACCGTCTGCGGCGTCCTCACCACCAACTTC
TCCGTCGTGTGCTGGGGCAACGAGAGGTTCCATGGGAGGCACCTCATCTTCAACGACACC
ATGCCCGGCGCGTGCGCCACCGTCGGCAACTGCTCCTCCAGCTGCGGCTTCGTCCCCGGC
TCCGCCGCGCTCTGCGGCAACGGCGGCGGCGAGGGCGGCGAGCAGCTCGTCGTGTGCCAG
CCCTGCAAGCTGCCGCTCAACGCGTCCAGGCTCGTCGTCGGGAATGGGACCAGCAAGAAT
GCGGCGGCGCCGACTGATTCCGGGAAGAACAGGAAGGCCGTCAAGGTCGCGGTCACCGCG
GCCTGCGTCGGCGTCGCGGCGCTCGTGGTGGCTGGGCTGGTGTTGTACCTCGCCGTCGTG
AGGAAGCGTGGCGGGAAGAAGAACGCCACCGTGCAGCTCGGCGAGTCGTCGACGCTGACC
CTCTGCCGCGACTTGGAGGGGGCCGTGATCATGCCGGCGCCGGAGGCATCGCCGCCGCCG
CCGCCGCTCGGGTGCGAAGAGTTCACGGTGAAGGAGCTCTCGCGGCTGACGAACGGGTTC
GCCGAGGAGAGGAAGATCGGGAGCGGCAGCTTCGGGTCGGTGTATCGCGCGAAGCTCCCC
GACGGGCGCGAGGTCGCCATCAAGCGCGCGGAGCGTCCGCGCGCGGCGTCGGGCGGCGGG
CGTCGCCGGCGCCGCCGGTACGACGCGGAGCGCGCGTTCCGGGCGGAGCTCCGGCTGCTG
TCCCGCGTGAACCACCGCAAcctggtgcagctgctgggcttctgcgaggagcgcggcgag
cgcatcctggtgttcgagttcatgccgcacggcgcgctgcacgaccacctccacggccgC
GTCGACGGCCACTCCCCGCTGTTCGCGTCGTGGGaggcgcggctccgggtggcgctcgac
gcggcgcgcggcgtcgagtacctgcattgctacgccgtgccgccgatcatccaccgcgac
atcaagccgtccaacatcctcctcgacggcgagtggaccgccaaggtgtcggacttcggg
ctgtcgctggcatcatcatcgtcgtcgtcggcgaccgcgacaccaccggcggcgtgctcg
acgtcgtcgacggcggggacggtggggtacatcgacccggagtactaccggctgcaggag
ctgacgcagcggagcgacgtgtacagcttcggCGTGGTGCTCCTCGAGCTGGTGACCGgg
aggaaggcgatccaccggcaggagggcgggagcgggtcgccgcggaacgtgatcgagttc
gccgtgccggcggtggaggcgggcggcgtcgggaggatcatggacgggcgcgtgccggcg
ccgcgcgggaacgaggcggaggcggtgtcgcgcgtggcgaggatcgcgagcgagtgcgtg
cggccgcgggggcgcgcgcggccggtgatgtcggaggtggtcgccgagctggagtgggcg
gtcACGCTCTGCGAGGAGTCCGTAGACCGGAGCTCCGCCGCCGCCCAGCAGCAGAACAGC
TCGCGGCACGGCGGCTCCGACGTGTCGCGGTCGGAGTCCGACGACCCCAGCCCCTTCCAC
ACGAGGGAGTTCGCCGGCGTCGGACATGGCAGGTCAAACTCAGCAATGTAA

Protein

837 aa

>Os08t0109800-01 Regulator of chromosome condensation/beta-lactamase-inhibitor protein II domain containing protein.
MPMSRHGALALTTSFLLAAVAVFLPGHAAARQFSTVAISNSPDATVVCALVRPKDVPDDV
PGAKLRCTSMPTGEVMSYPSADVPYNAIAAGTDFLCGLMAPNGGHAAMRWWSFSDEAAAN
RSRPVGRRLYWGPSLRALSAGGPHVCGLSDAHDPTCWEWPGLSLPKGLDFSRIALGRDFL
CGVVKGNASAMTCFGGGMAPPAFAGAASIVAVAAGHRHACAVDDDGGMSCWGEGYPDMRP
GDLPADMKSMALGRNTTCILDGDDMVRCWGVEVPEEYRRASFVSIEADGDTVCGVLTTNF
SVVCWGNERFHGRHLIFNDTMPGACATVGNCSSSCGFVPGSAALCGNGGGEGGEQLVVCQ
PCKLPLNASRLVVGNGTSKNAAAPTDSGKNRKAVKVAVTAACVGVAALVVAGLVLYLAVV
RKRGGKKNATVQLGESSTLTLCRDLEGAVIMPAPEASPPPPPLGCEEFTVKELSRLTNGF
AEERKIGSGSFGSVYRAKLPDGREVAIKRAERPRAASGGGRRRRRRYDAERAFRAELRLL
SRVNHRNLVQLLGFCEERGERILVFEFMPHGALHDHLHGRVDGHSPLFASWEARLRVALD
AARGVEYLHCYAVPPIIHRDIKPSNILLDGEWTAKVSDFGLSLASSSSSSATATPPAACS
TSSTAGTVGYIDPEYYRLQELTQRSDVYSFGVVLLELVTGRKAIHRQEGGSGSPRNVIEF
AVPAVEAGGVGRIMDGRVPAPRGNEAEAVSRVARIASECVRPRGRARPVMSEVVAELEWA
VTLCEESVDRSSAAAQQQNSSRHGGSDVSRSESDDPSPFHTREFAGVGHGRSNSAM*

5'UTR

chr08:496929..497001 (+ strand) : 73 bp

CDS

chr08:497002..499512 (+ strand) : 2511 bp

3'UTR

chr08:499513..500019 (+ strand) : 507 bp

FASTA

>Os08t0109800-01 class=Sequence position=chr08:496929..500019 (+ strand)
TTTCTTCCAT TTCCAAAGCC AAGAAAGAAA GGGAGGAGTA AGTCTCCCCC ATGTCGTCTT CTCCTCGCTC CCAATGCCAA
TGTCTCGCCA TGGCGCCCTT GCTCTGACCA CCTCCTTCCT CCTCGCGGCC GTCGCCGTCT TCCTTCCCGG GCACGCGGCG
GCGCGGCAGT TCTCCACCGT CGCCATCTCC AACTCCCCCG ACGCGACGGT CGTGTGCGCG CTCGTCCGCC CCAAGGACGT
GCCCGATGAT GTCCCCGGCG CCAAGCTGCG GTGCACCTCC ATGCCCACCG GCGAGGTCAT GTCCTACCCC TCCGCGGACG
TCCCCTACAA CGCCATCGCC GCCGGCACCG ACTTCCTGTG CGGCCTCATG GCGCCCAACG GCGGCCACGC CGCCATGCGC
TGGTGGTCCT TCTCCGACGA GGCCGCCGCC AACCGCTCCC GCCCCGTCGG CCGCCGCCTC TACTGGGGCC CTTCCCTCCG
CGCCCTCTCC GCCGGTGGCC CTCACGTCTG CGGCCTCTCC GACGCCCACG ACCCGACGTG CTGGGAGTGG CCGGGGTTGA
GCTTGCCCAA GGGCCTCGAC TTCTCCCGCA TCGCCCTCGG CCGCGACTTC CTCTGCGGCG TCGTCAAGGG CAACGCCTCC
GCCATGACCT GCTTCGGCGG CGGCATGGCG CCGCCCGCGT TCGCCGGGGC TGCTTCCATC GTGGCGGTCG CCGCCGGCCA
CCGCCACGCC TGCGCCGTCG ACGACGACGG CGGCATGTCG TGCTGGGGCG AAGGGTACCC GGACATGCGC CCCGGCGACC
TCCCCGCCGA CATGAAGTCC ATGGCGCTGG GGCGGAACAC GACGTGCATC CTCGACGGCG ACGACATGGT GCGGTGCTGG
GGCGTGGAGG TGCCCGAGGA GTACAGGCGC GCGTCGTTCG TGTCCATCGA GGCCGACGGC GACACCGTCT GCGGCGTCCT
CACCACCAAC TTCTCCGTCG TGTGCTGGGG CAACGAGAGG TTCCATGGGA GGCACCTCAT CTTCAACGAC ACCATGCCCG
GCGCGTGCGC CACCGTCGGC AACTGCTCCT CCAGCTGCGG CTTCGTCCCC GGCTCCGCCG CGCTCTGCGG CAACGGCGGC
GGCGAGGGCG GCGAGCAGCT CGTCGTGTGC CAGCCCTGCA AGCTGCCGCT CAACGCGTCC AGGCTCGTCG TCGGGAATGG
GACCAGCAAG AATGCGGCGG CGCCGACTGA TTCCGGGAAG AACAGGAAGG CCGTCAAGGT CGCGGTCACC GCGGCCTGCG
TCGGCGTCGC GGCGCTCGTG GTGGCTGGGC TGGTGTTGTA CCTCGCCGTC GTGAGGAAGC GTGGCGGGAA GAAGAACGCC
ACCGTGCAGC TCGGCGAGTC GTCGACGCTG ACCCTCTGCC GCGACTTGGA GGGGGCCGTG ATCATGCCGG CGCCGGAGGC
ATCGCCGCCG CCGCCGCCGC TCGGGTGCGA AGAGTTCACG GTGAAGGAGC TCTCGCGGCT GACGAACGGG TTCGCCGAGG
AGAGGAAGAT CGGGAGCGGC AGCTTCGGGT CGGTGTATCG CGCGAAGCTC CCCGACGGGC GCGAGGTCGC CATCAAGCGC
GCGGAGCGTC CGCGCGCGGC GTCGGGCGGC GGGCGTCGCC GGCGCCGCCG GTACGACGCG GAGCGCGCGT TCCGGGCGGA
GCTCCGGCTG CTGTCCCGCG TGAACCACCG CAAcctggtg cagctgctgg gcttctgcga ggagcgcggc gagcgcatcc
tggtgttcga gttcatgccg cacggcgcgc tgcacgacca cctccacggc cgCGTCGACG GCCACTCCCC GCTGTTCGCG
TCGTGGGagg cgcggctccg ggtggcgctc gacgcggcgc gcggcgtcga gtacctgcat tgctacgccg tgccgccgat
catccaccgc gacatcaagc cgtccaacat cctcctcgac ggcgagtgga ccgccaaggt gtcggacttc gggctgtcgc
tggcatcatc atcgtcgtcg tcggcgaccg cgacaccacc ggcggcgtgc tcgacgtcgt cgacggcggg gacggtgggg
tacatcgacc cggagtacta ccggctgcag gagctgacgc agcggagcga cgtgtacagc ttcggCGTGG TGCTCCTCGA
GCTGGTGACC Gggaggaagg cgatccaccg gcaggagggc gggagcgggt cgccgcggaa cgtgatcgag ttcgccgtgc
cggcggtgga ggcgggcggc gtcgggagga tcatggacgg gcgcgtgccg gcgccgcgcg ggaacgaggc ggaggcggtg
tcgcgcgtgg cgaggatcgc gagcgagtgc gtgcggccgc gggggcgcgc gcggccggtg atgtcggagg tggtcgccga
gctggagtgg gcggtcACGC TCTGCGAGGA GTCCGTAGAC CGGAGCTCCG CCGCCGCCCA GCAGCAGAAC AGCTCGCGGC
ACGGCGGCTC CGACGTGTCG CGGTCGGAGT CCGACGACCC CAGCCCCTTC CACACGAGGG AGTTCGCCGG CGTCGGACAT
GGCAGGTCAA ACTCAGCAAT GTAAAAAAAA AAAACAAACG AGTTTTATTT TTTTATCCTT TTTTTATTTA TTTTCTTTGT
TTTGTTTTAA TTAGTTTCCA CGGTTGCTGG AATAGGATGA ATTAGTTGCT GTGCATAAAC ATTTTTCAAA GAGGAAAAAA
AAGATACTGA GAGGGAGTAT TCATTTTGAT GTTGATTGTT ACTTGAATTA GTCTAGGAGA GTTTTTGATT GCTTTTGCTC
TGTGAACAAA ATTCATAAGA GTTTGACAAA ATCTAACATG TACGTTGTAT ATCAAGATTT ATTGACACAA CATAATAATA
TAATAATAAT ACTAGTTGGA GTAGTGGGTG GTTTGTAAGT ACAATCTTGT TTTTTCTTCT GTTTTGATTT GTTAGCTTAG
AAATTTTCGG AGGGTTGGTA GGTTAGATTA GACAAAATTA TTAATTTGTG GCCTTGTGAG AGTGTGGAGA TGCAACAACT
GTACTTCTTC CAACAAACTG CTTTTATTAT ATAATGTAAT ACTTGGAGTG C

Locus: Os08g0109800

Loading...

Locus: Os08g0109800

Loading...