Os08t0112800-01

Locus

Os08g0112800

Description

Rickettsia 17 kDa surface antigen family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SDH6

CGSNL Gene Name

SUCCINATE DEHYDROGENASE SUBUNIT 6

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

SUCCINATE:UBIQUINONE OXIDOREDUCTASE

Transcript Evidence

AK121176 (DDBJ, Best hit)

Protein Evidence

A2YQL0 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J023083C18 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0112800-01)

RiceXPro (AK121176)

Others

Oryzabase (8752)

KEGG (Os08t0112800-01)

Transcript

829 bp

>Os08t0112800-01 Rickettsia 17 kDa surface antigen family protein.
AGGTAGAAGCCAAACGCGAGGCGAAACCACCACACCTCACCGTCGAATCGAATCCAAGGC
GGCGGCGGCGGCGGCGGCGGCGGCGGCGATGGGGATCCACGAGCACGTCGAGGGGATCAA
GGCGCACTGGGCGAAGAACTTCTCCTTCCTCGACTACTTCAAGAAGGTCTACGGCCGGGA
CAAGCCCCTCCCCAAGTGGACCGATGCCGACGTCGACGAGTTCATCGCCTCCGATCCCGT
CTACGGCCCGCAGCTCAAGGCGATGAGGGAATCCAGGAAGTTCGCGCTCGGCGGGGCTCT
CGTCGGCGGCGCGCACCTCGGCGGCATCGCCCTCAAGTACTCCAAGGCCCCGCACGGTGT
CGTCCTGGCCACCGGCTTCGGGGCGATCTGCGGCGCCGTCGTCGGATCGGAGGTGGCGGA
GCACTGGTACCAGCTCTACAAGACGGACAAGCAGGGGGCCAACCTAAGGTTCATCTACTG
GTGGGAGGACAAGGTCGCAGGAAACCAGAAAAGTTGAGTGGTGTCTATCTGGTCCAGCAG
CTTGGCAAGAGTGATGTCCCCCCGCTGGGATTTTTAGTTGCTCATTCCTAGTATTTCCAA
ATAAGGTGTGTATTGGTTGTGACGATTACGCAGATGGAGTATGTTTCCTTTTGCTAGTAC
CGTGAGCTCTGTCTGTTCACAGCCTGAACAACAACTTTTGTGCTCTGAATGGTTCACAAA
CTAAATGCTGATCTTTACCGGTATCTGTTGATCTTTGTCCATTAAAGATTACTTTGCATA
TTGTAAGTACTGCTTTACCTTGAAGATAATAAGGCTACATAACGTAACC

CDS

429 bp

>Os08t0112800-01 Rickettsia 17 kDa surface antigen family protein.
ATGGGGATCCACGAGCACGTCGAGGGGATCAAGGCGCACTGGGCGAAGAACTTCTCCTTC
CTCGACTACTTCAAGAAGGTCTACGGCCGGGACAAGCCCCTCCCCAAGTGGACCGATGCC
GACGTCGACGAGTTCATCGCCTCCGATCCCGTCTACGGCCCGCAGCTCAAGGCGATGAGG
GAATCCAGGAAGTTCGCGCTCGGCGGGGCTCTCGTCGGCGGCGCGCACCTCGGCGGCATC
GCCCTCAAGTACTCCAAGGCCCCGCACGGTGTCGTCCTGGCCACCGGCTTCGGGGCGATC
TGCGGCGCCGTCGTCGGATCGGAGGTGGCGGAGCACTGGTACCAGCTCTACAAGACGGAC
AAGCAGGGGGCCAACCTAAGGTTCATCTACTGGTGGGAGGACAAGGTCGCAGGAAACCAG
AAAAGTTGA

Protein

142 aa

>Os08t0112800-01 Rickettsia 17 kDa surface antigen family protein.
MGIHEHVEGIKAHWAKNFSFLDYFKKVYGRDKPLPKWTDADVDEFIASDPVYGPQLKAMR
ESRKFALGGALVGGAHLGGIALKYSKAPHGVVLATGFGAICGAVVGSEVAEHWYQLYKTD
KQGANLRFIYWWEDKVAGNQKS*

5'UTR

chr08:684049..684136 (- strand) : 88 bp

CDS

chr08:683884..684048 (- strand) : 165 bp

chr08:683681..683783 (- strand) : 103 bp

chr08:683449..683592 (- strand) : 144 bp

chr08:682957..682973 (- strand) : 17 bp

3'UTR

chr08:682645..682956 (- strand) : 312 bp

FASTA

>Os08t0112800-01 class=Sequence position=chr08:682645..684136 (- strand)
AGGTAGAAGC CAAACGCGAG GCGAAACCAC CACACCTCAC CGTCGAATCG AATCCAAGGC GGCGGCGGCG GCGGCGGCGG
CGGCGGCGAT GGGGATCCAC GAGCACGTCG AGGGGATCAA GGCGCACTGG GCGAAGAACT TCTCCTTCCT CGACTACTTC
AAGAAGGTCT ACGGCCGGGA CAAGCCCCTC CCCAAGTGGA CCGATGCCGA CGTCGACGAG TTCATCGCCT CCGATCCCGT
CTACGGCCCG CAGGTCACCC TCCTCCTCCT CCTTCCCGCA CAATCCGTCT CCTGCTCGTC CGGCCGCCCG TCTAACCACG
CGAATTTTCC CGATCCCCCC TGTGTTTTTG CAGCTCAAGG CGATGAGGGA ATCCAGGAAG TTCGCGCTCG GCGGGGCTCT
CGTCGGCGGC GCGCACCTCG GCGGCATCGC CCTCAAGTAC TCCAAGGCCC CGCACGGTAT CACCACCAAT CGCGACCTAT
CTAGTAATTT CAACTTGCGC TGTGATTGCG CGTGCATCCG GTGCCTGATT TGGTTGGGCT GCAGGTGTCG TCCTGGCCAC
CGGCTTCGGG GCGATCTGCG GCGCCGTCGT CGGATCGGAG GTGGCGGAGC ACTGGTACCA GCTCTACAAG ACGGACAAGC
AGGGGGCCAA CCTAAGGTTC ATCTACTGGT GGGAGGACAA GGTCGCAGGT ATCATACCAC CTTCTTCGTC TCTTGTTCTT
CTCATTCTCA TGTGCTTTAC TTGCTCTAAT TCGATCAGGC CATTTCCTTT GCAAGTGAAC ACTACATCAC AATGATGATT
CCGGTAGTTG ATTTCCGATG TAAAATTTGT AGTAATTATG AGGTATCAAT ATTGTGCCCC TTTAGTGAAT TGGGAATATT
AGTTTGCAAT CATGAGATGG TCTATAATAC AGTTGGAATG GGCTAGGAAT ATCGAGTCGT GAATGCGAGG TGTCGACTCT
ATGCTGTTTG AGTAACTTAG AAACGTTTGA AGAATACAAC GAAGTTGTGT GTCAGTTTTT GGTCGTGGAC AGTTGTTAAC
ACAACTGATC AGGATAAAGG GACTGCATGA TGTTGTTCCA TTGAGCTAGC AAGTAAATGC ATCGCATTTG AAGGCCTCCT
TCTAACCGTG TTCGATTTTC TTTTTGGGTG CTTTTGTGAA CAGGAAACCA GAAAAGTTGA GTGGTGTCTA TCTGGTCCAG
CAGCTTGGCA AGAGTGATGT CCCCCCGCTG GGATTTTTAG TTGCTCATTC CTAGTATTTC CAAATAAGGT GTGTATTGGT
TGTGACGATT ACGCAGATGG AGTATGTTTC CTTTTGCTAG TACCGTGAGC TCTGTCTGTT CACAGCCTGA ACAACAACTT
TTGTGCTCTG AATGGTTCAC AAACTAAATG CTGATCTTTA CCGGTATCTG TTGATCTTTG TCCATTAAAG ATTACTTTGC
ATATTGTAAG TACTGCTTTA CCTTGAAGAT AATAAGGCTA CATAACGTAA CC

Locus: Os08g0112800

Loading...

Locus: Os08g0112800

Loading...