Os08t0116500-01

Locus

Os08g0116500

Description

Similar to 60S acidic ribosomal protein P1 (L12).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Ribosomal protein L12eII, Acidic ribosomal protein P2, Ribosomal protein rp21c

Transcript Evidence

AK058240 (DDBJ, Best hit)

Protein Evidence

Q5I7K5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: translational elongation (GO:0006414)

Cellular Component: intracellular (GO:0005622)

Cellular Component: ribosome (GO:0005840)

Molecular Function: structural constituent of ribosome (GO:0003735)

Functional domain (InterPro)

Ribosomal protein 60S (IPR001813)

Full-length cDNA

001-011-G09 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0116500-01)

RiceXPro (AK058240)

Others

Oryzabase (17660)

KEGG (Os08t0116500-01)

Transcript

631 bp

>Os08t0116500-01 Similar to 60S acidic ribosomal protein P1 (L12).
TAGAAGCCCCCCTGCCTCCTGCGCCTCCGCCGCCGCCGCCTTCTTCGTCTGCTGAGTTCG
TAGATCAGCTCGAGCTCGCCGCCATGTCGTCCAGCGAGGTCGCCTGCACGCTCGCCGCCC
TCATCCTCCACGACGATGGCATCCCCATCACCTCTGAGAAGATCGCCACCCTGGTGAAGG
CGGCCAACATCAAGGTCGAGGCCTACTGGCCCGGTCTCTTCGCCAAGCTCCTCGAGCACC
GCAGCGTCGATGACCTCATCCTCTCCGTCGGATCTGGTGGTGGTGCTGCTCCAGTTGCTG
CTGCTGCTGCCCCTGCTGCTGGCGGTGGTGCTGCTGCTGCCCCAGCTGCCGAGGAGAAGA
AGGAGGAGGCGAAGGAGGAGAGCGACGATGACATGGGTTTCAGCTTGTTCGACTAAGCAG
TCCACAGATGTTAGCCAGTCCGCCTATGCTTTGCAAGACTATCTTATGTTGTGTCTTTTA
GGTTCACTTAAAGTACTCTCAAGTTTTGAGTTTTGATATGGTGTTATCGAGAATCTGTGT
CTGTGGGATGAGAACCTCAAACCTCCTTGGATGGTCCTATTAGAATGAAACCGTTCTACA
TTCTTATATCTAGCTCTTTTATTCTGTGGTC

CDS

333 bp

>Os08t0116500-01 Similar to 60S acidic ribosomal protein P1 (L12).
ATGTCGTCCAGCGAGGTCGCCTGCACGCTCGCCGCCCTCATCCTCCACGACGATGGCATC
CCCATCACCTCTGAGAAGATCGCCACCCTGGTGAAGGCGGCCAACATCAAGGTCGAGGCC
TACTGGCCCGGTCTCTTCGCCAAGCTCCTCGAGCACCGCAGCGTCGATGACCTCATCCTC
TCCGTCGGATCTGGTGGTGGTGCTGCTCCAGTTGCTGCTGCTGCTGCCCCTGCTGCTGGC
GGTGGTGCTGCTGCTGCCCCAGCTGCCGAGGAGAAGAAGGAGGAGGCGAAGGAGGAGAGC
GACGATGACATGGGTTTCAGCTTGTTCGACTAA

Protein

111 aa

>Os08t0116500-01 Similar to 60S acidic ribosomal protein P1 (L12).
MSSSEVACTLAALILHDDGIPITSEKIATLVKAANIKVEAYWPGLFAKLLEHRSVDDLIL
SVGSGGGAAPVAAAAAPAAGGGAAAAPAAEEKKEEAKEESDDDMGFSLFD*

5'UTR

chr08:904128..904181 (+ strand) : 54 bp

chr08:904286..904314 (+ strand) : 29 bp

CDS

chr08:904315..904383 (+ strand) : 69 bp

chr08:904493..904616 (+ strand) : 124 bp

chr08:905156..905241 (+ strand) : 86 bp

chr08:905341..905394 (+ strand) : 54 bp

3'UTR

chr08:905395..905609 (+ strand) : 215 bp

FASTA

>Os08t0116500-01 class=Sequence position=chr08:904128..905609 (+ strand)
TAGAAGCCCC CCTGCCTCCT GCGCCTCCGC CGCCGCCGCC TTCTTCGTCT GCTGGTACGC CGCCCTTCGC CGCCGCCGCC
TCCGCATCCA ATCTGCGTTG TTCTTCCGCC GATTTCGATT GCCTCACCCT TCGTTTTGTT TCTTGATTGA TCTCGCAGAG
TTCGTAGATC AGCTCGAGCT CGCCGCCATG TCGTCCAGCG AGGTCGCCTG CACGCTCGCC GCCCTCATCC TCCACGACGA
TGGCATCCCC ATCACCGTGC GTTACTACAC CTTCACCCCT ATCTTGATTT TGCTTTTCTT GGCTTGGGGT GGATTTGGTG
TGTGAGATTG ATTATTTATT TTGTTGGTGA TTTGGTGACG AGCAGTCTGA GAAGATCGCC ACCCTGGTGA AGGCGGCCAA
CATCAAGGTC GAGGCCTACT GGCCCGGTCT CTTCGCCAAG CTCCTCGAGC ACCGCAGCGT CGATGACCTC ATCCTCTCCG
TCGGATCTGG TAAAACCTCC CGGCCCCTTG TCCCCTGCCT CCTTGCTATG CCACTGCGTG ATTGTCGATG TAGATTTGAT
TGAACCTAGT TTATCTCATG AGGGAAATTA CCATAGATTT ATATAGGGTT TGTCATGAAG ATGTAATCCT ATTAGTTGGT
TGCTTCGGTT AACCTTTGTG CAATTTAGTA ATTGTAGTTA TACATCTGTT ATCTCATGAA CATTGCGATT GCCATCGGAA
TTATATAGTT TGGTGTAGAT TATTACAACT TAGTTACTAG TTATGCCGTG GAATTGTCTT GATCATGTGT TCTATTCTAA
TCGTGTCAAT GTTGTTTGGA AGTTAAAAGC TGTTTTGAGC TGTTGTCATG TTTCATCTTT GCCATATTTA ACTAGGAAAC
TTGAGCATGT CAATTCTGTT AATATTATGT TGTGTATGAG TTCTGGTTCT AGGATTACTT GTTTCATTCT GTTAATAAAT
CGTTATATAC ATGTTTGTGA TCTTAAAACA AATATTGTAT TTACTTTGTG CATCGATTAT GGTTGTAGGT GGTGGTGCTG
CTCCAGTTGC TGCTGCTGCT GCCCCTGCTG CTGGCGGTGG TGCTGCTGCT GCCCCAGCTG CCGAGGAGAA GAAGGTGAGC
TATACATACA ATTTGCTTGT TATTTTTGTC ATGACACATG TATGTTTTGT TTTGTTTTGT AACTTACAAA TGTCTTGGTT
TTCCTCTTAT CAGGAGGAGG CGAAGGAGGA GAGCGACGAT GACATGGGTT TCAGCTTGTT CGACTAAGCA GTCCACAGAT
GTTAGCCAGT CCGCCTATGC TTTGCAAGAC TATCTTATGT TGTGTCTTTT AGGTTCACTT AAAGTACTCT CAAGTTTTGA
GTTTTGATAT GGTGTTATCG AGAATCTGTG TCTGTGGGAT GAGAACCTCA AACCTCCTTG GATGGTCCTA TTAGAATGAA
ACCGTTCTAC ATTCTTATAT CTAGCTCTTT TATTCTGTGG TC