Os08t0137250-01

Locus

Os08g0137250

Description

Esc-like core component of the polycomb repressive complex 2, Seed size regulation under heat stress

RAP-DB Gene Symbol Synonym(s)

FIE1, OsFIE1, OsWD40-154, OsEnS-116

RAP-DB Gene Name Synonym(s)

FERTILIZATION-INDEPENDENT ENDOSPERM 1, FERTILIZATION-INDEPENDENT ENDOSPERM1, Fertilization-Independent Endosperm 1, dwarf and flower aberrant mutant, endosperm-specific gene 116

CGSNL Gene Symbol

FIE1

CGSNL Gene Name

FERTILIZATION-INDEPENDENT ENDOSPERM 1

Oryzabase Gene Symbol Synonym(s)

OsFIE1, OsWD40-154, OsEnS-116, OsFIE1/OsWD40-154, WD40-154

Oryzabase Gene Name Synonym(s)

FERTILIZATION-INDEPENDENT ENDOSPERM1, Fertilization-Independent Endosperm 1, dwarf and flower aberrant mutant, endosperm-specific gene 116

Transcript Evidence

AK242200

Protein Evidence

Q6ZJW8

Literature

PMID: 24590858

PMID: 23150632

Note

Manual Curation

May 9, 2014

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

WD40/YVTN repeat-like-containing domain (IPR015943)

WD40-repeat-containing domain (IPR017986)

WD40 repeat (IPR001680)

G-protein beta WD-40 repeat (IPR020472)

WD40 repeat, conserved site (IPR019775)

Full-length cDNA

J075166M12 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0137250-01)

Others

Oryzabase (8841)

KEGG (Os08t0137250-01)

Transcript

1748 bp

>Os08t0137250-01 Esc-like core component of the polycomb repressive complex 2, Seed size regulation under heat stress
TCCACCCCGCCCGCCGCCGCTCCCTATTCCTATTTAATCCCATCTCTCTTCCTCATCACC
GCTCTCCTCTCTCCAGGCAAGAGGAAGTACGCAACCTCAAGCCGGACAAGACGTGAGCAA
AGATGGGCCCCACTAGTAGGAACCATAAATCATCTCAAAAAGATGTGGCACCGAATGAAG
CCAAACCACCCCGATATCCAcagcgcaaccgctccatcactgcctctgcctctgcctctg
cctttgcctctcccgctgttgccaactccagagttgccaaggAAAGGCCATCTTCATCAA
CTGCTGGTGAAGGTGAACCACAGGAAACGGTGCTAAAGCTTCCAAGCATCCCAACACTTC
CTGCACGGATGGCAAAGTTGGTGCCATTAGAGGGGTTGGGATGCGAGGCAGCGGTGGGAT
CGCTAACACCGAGTCGGGAGCGAGAATACAAGGTGACCAACAAGCACACTGAGGGAAGGC
GCCCTGTCTACGCCATTGTCTTCAATTTCCTCGATGTTCGCTACTACGACATCTTCGCCA
CCGCCTGTGGCCCTCGTCTTTCAACCTACCGCTGCCTCATGAATGGCAAATTTGCTCTTC
TGCAAAGCTATCTTGATGACGATATGAATGAGTCATTCTTCACTGTGAGCTGGGCTTGCG
ACATTGATGGCAATCCATTGTTAGTAGCTGCAGGAAGCACTGGAATCATTCGAGTCATCA
ACTGTGCCACTGAGAAGATATATAAGAGTCTTGTTGGCCATGGTGGTTCAGTAAACGAAA
TAAAGTCTCAACCATCGAATCCTTCACTCATCATTTCTGCAAGCAAGGATGAATCTATTA
AGCTGTGGAATGTGCAGACAGGGATCTTAATTTTGGTTTTTGGTGGAGTAGGAGGTCACC
GACACGAAGTACTTGGTGTTGACTTCCACACATCTGATATCTACCGCTTTTTAAGTTGTG
GAATGGACAACACTGTGAGAATCTGGTCAATGAAAGAATTCTGGGAATATGTTGAGAAAT
CCTATTCATGGACTGATGCTACATCAAAATTTCCAACAAAATTTGTCCAATTTCCGGTCC
TGTGTGCTGAAATACATTCTAACTATGTAGACTGTACTAAATGGCTTGGGGACTTTGTCC
TGTCAAAGAGTGTTGAAAATGAAATCTTGCTGTGGGAATCGATCACAAAAGAAGAAAACC
CTGGCGAGGGTCACATTGATGTTCTTCAGAAGTACCCTGTGCCAGAATGTAACATCTGGT
TCATGAAATTCTCATGTGATTTTCACCACAATCAGTTGGCAATAGGAAACCGTGATGGTA
AAGTCTATGTCTGGAAAGTACAGACCAGCCCTCCTGTTCTAATTGCTCGGCTCAATAATC
CACAAGTGAAATCAGCCATAAGGCAGACTGCAGTGTCCTTTGATGGAAGCACAATCCTTG
CCTGCACAGAGGATGGCAACATATGGCGTTGGGATGAAGTGGATCACCCAACCGCCCCAG
TCCCAAGCAAGAAACAAAAGTGAAGCAAGGATTATATTAATTGAAATTAATAAGGCTGAA
TTGGCGATTTGTTCTTGGTATACTTTGTTATACTACTTTGCCTTAGCGTTCATCAAAACT
GCCATTTGATTTTCCAACATTCAGAAAACTCTATAGCTGGATGTAAGATTTATTATCGCA
AGATATTCAGGATGTTGGTCGGTGACTTGGTTTTATCAATAATTTGCTGGGAATATAGTA
CTTAATCT

CDS

1401 bp

>Os08t0137250-01 Esc-like core component of the polycomb repressive complex 2, Seed size regulation under heat stress
ATGGGCCCCACTAGTAGGAACCATAAATCATCTCAAAAAGATGTGGCACCGAATGAAGCC
AAACCACCCCGATATCCAcagcgcaaccgctccatcactgcctctgcctctgcctctgcc
tttgcctctcccgctgttgccaactccagagttgccaaggAAAGGCCATCTTCATCAACT
GCTGGTGAAGGTGAACCACAGGAAACGGTGCTAAAGCTTCCAAGCATCCCAACACTTCCT
GCACGGATGGCAAAGTTGGTGCCATTAGAGGGGTTGGGATGCGAGGCAGCGGTGGGATCG
CTAACACCGAGTCGGGAGCGAGAATACAAGGTGACCAACAAGCACACTGAGGGAAGGCGC
CCTGTCTACGCCATTGTCTTCAATTTCCTCGATGTTCGCTACTACGACATCTTCGCCACC
GCCTGTGGCCCTCGTCTTTCAACCTACCGCTGCCTCATGAATGGCAAATTTGCTCTTCTG
CAAAGCTATCTTGATGACGATATGAATGAGTCATTCTTCACTGTGAGCTGGGCTTGCGAC
ATTGATGGCAATCCATTGTTAGTAGCTGCAGGAAGCACTGGAATCATTCGAGTCATCAAC
TGTGCCACTGAGAAGATATATAAGAGTCTTGTTGGCCATGGTGGTTCAGTAAACGAAATA
AAGTCTCAACCATCGAATCCTTCACTCATCATTTCTGCAAGCAAGGATGAATCTATTAAG
CTGTGGAATGTGCAGACAGGGATCTTAATTTTGGTTTTTGGTGGAGTAGGAGGTCACCGA
CACGAAGTACTTGGTGTTGACTTCCACACATCTGATATCTACCGCTTTTTAAGTTGTGGA
ATGGACAACACTGTGAGAATCTGGTCAATGAAAGAATTCTGGGAATATGTTGAGAAATCC
TATTCATGGACTGATGCTACATCAAAATTTCCAACAAAATTTGTCCAATTTCCGGTCCTG
TGTGCTGAAATACATTCTAACTATGTAGACTGTACTAAATGGCTTGGGGACTTTGTCCTG
TCAAAGAGTGTTGAAAATGAAATCTTGCTGTGGGAATCGATCACAAAAGAAGAAAACCCT
GGCGAGGGTCACATTGATGTTCTTCAGAAGTACCCTGTGCCAGAATGTAACATCTGGTTC
ATGAAATTCTCATGTGATTTTCACCACAATCAGTTGGCAATAGGAAACCGTGATGGTAAA
GTCTATGTCTGGAAAGTACAGACCAGCCCTCCTGTTCTAATTGCTCGGCTCAATAATCCA
CAAGTGAAATCAGCCATAAGGCAGACTGCAGTGTCCTTTGATGGAAGCACAATCCTTGCC
TGCACAGAGGATGGCAACATATGGCGTTGGGATGAAGTGGATCACCCAACCGCCCCAGTC
CCAAGCAAGAAACAAAAGTGA

Protein

467 aa

>Os08t0137250-01 Esc-like core component of the polycomb repressive complex 2, Seed size regulation under heat stress
MGPTSRNHKSSQKDVAPNEAKPPRYPQRNRSITASASASAFASPAVANSRVAKERPSSST
AGEGEPQETVLKLPSIPTLPARMAKLVPLEGLGCEAAVGSLTPSREREYKVTNKHTEGRR
PVYAIVFNFLDVRYYDIFATACGPRLSTYRCLMNGKFALLQSYLDDDMNESFFTVSWACD
IDGNPLLVAAGSTGIIRVINCATEKIYKSLVGHGGSVNEIKSQPSNPSLIISASKDESIK
LWNVQTGILILVFGGVGGHRHEVLGVDFHTSDIYRFLSCGMDNTVRIWSMKEFWEYVEKS
YSWTDATSKFPTKFVQFPVLCAEIHSNYVDCTKWLGDFVLSKSVENEILLWESITKEENP
GEGHIDVLQKYPVPECNIWFMKFSCDFHHNQLAIGNRDGKVYVWKVQTSPPVLIARLNNP
QVKSAIRQTAVSFDGSTILACTEDGNIWRWDEVDHPTAPVPSKKQK*

5'UTR

chr08:2095644..2095726 (+ strand) : 83 bp

chr08:2095848..2095886 (+ strand) : 39 bp

CDS

chr08:2095887..2095927 (+ strand) : 41 bp

chr08:2096040..2096433 (+ strand) : 394 bp

chr08:2097141..2097206 (+ strand) : 66 bp

chr08:2097411..2097533 (+ strand) : 123 bp

chr08:2097949..2098029 (+ strand) : 81 bp

chr08:2098109..2098201 (+ strand) : 93 bp

chr08:2098447..2098522 (+ strand) : 76 bp

chr08:2098599..2098678 (+ strand) : 80 bp

chr08:2098777..2098848 (+ strand) : 72 bp

chr08:2099281..2099340 (+ strand) : 60 bp

chr08:2099521..2099617 (+ strand) : 97 bp

chr08:2099842..2099905 (+ strand) : 64 bp

chr08:2100050..2100109 (+ strand) : 60 bp

chr08:2100286..2100379 (+ strand) : 94 bp

3'UTR

chr08:2100380..2100604 (+ strand) : 225 bp

FASTA

>Os08t0137250-01 class=Sequence position=chr08:2095644..2100604 (+ strand)
TCCACCCCGC CCGCCGCCGC TCCCTATTCC TATTTAATCC CATCTCTCTT CCTCATCACC GCTCTCCTCT CTCCAGGCAA
GAGGTACGCA CTTTTTGTTT CGGATTTGAA ATCTTTGCTT CGTTTTACTA TCATTGGTCA TAAGTTCTTT TTTGAAGATG
TTTGAGAATA AGTTTATCAT TGAGATTATC GTCACTTGTG ATAGGAAGTA CGCAACCTCA AGCCGGACAA GACGTGAGCA
AAGATGGGCC CCACTAGTAG GAACCATAAA TCATCTCAAA AAGAGTAAGT GGTATTCTTA TATAGCACAC ATTTTTTAAG
GATATATACA TGTTTCCCAC AAATGTTTCA AACACATATA GTGATATATT TAAATCCGAC AACATTTGAA TTGAAGTGTG
GCACCGAATG AAGCCAAACC ACCCCGATAT CCAcagcgca accgctccat cactgcctct gcctctgcct ctgcctttgc
ctctcccgct gttgccaact ccagagttgc caaggAAAGG CCATCTTCAT CAACTGCTGG TGAAGGTGAA CCACAGGAAA
CGGTGCTAAA GCTTCCAAGC ATCCCAACAC TTCCTGCACG GATGGCAAAG TTGGTGCCAT TAGAGGGGTT GGGATGCGAG
GCAGCGGTGG GATCGCTAAC ACCGAGTCGG GAGCGAGAAT ACAAGGTGAC CAACAAGCAC ACTGAGGGAA GGCGCCCTGT
CTACGCCATT GTCTTCAATT TCCTCGATGT TCGCTACTAC GACATCTTCG CCACCGCCTG TGGCCCTCGT GTAAGATTTC
TTACGAGGCG CCATATTGAT CTTACTAGGG AAGTAGTAGC GCTTCATGTT TCTATAAATA GATCAAAATC TAGTATTTAC
CTTATTATCC TATTCGCATT AGATGTTTTT AATCTGACTT TGTGTCACGT CCCTTTTTTC ATGTTTCTTA ATTTGCCTAT
TTTGAAAATT CACATTCGTG TTCATTCACC TAAAATAGCT TAATGAAAAT TTCATAAATA TTTTTGTTTA AAATTTGACT
AAATAAAATA ATCATGCTGC CATTTATTTT ATTGTTTGTT AATTGGAGTT ATGGTTTTTT ATTCGAGTTT GGAAGTGGAG
CTCAACTCTG TGAATTATTA TCAATCTAGA AATATTCCTC AAAATTATTT TTGTTTTATA TTTATTAatg taatcgtgat
gtggttatga tattaccttt tgttattgtg tgtgctagag ttgatctggg actaacacat tatacacaga gggatcctag
ttggggtccc gacactttgc gaatGCGCTT TACACTTTAA AAGTGCATTA AAAAATATAA TTTTGTTGAA TATTTTGATA
AAAATATAAT TAGGGGAAGG AATTATAAGA TCATAGATTT CATTGATCAT AAAATTAAAT TTTAAGGATG GAGTTATGCA
CATATGTTAT TTTCAATGTG TTTATGCTAA CACGTTGCGC CCTCGTGACC TTTGCAGCTT TCAACCTACC GCTGCCTCAT
GAATGGCAAA TTTGCTCTTC TGCAAAGCTA TCTTGATGAC GATGTAAGCT CTGCCAATAA TTTTGAGTGT TCAGTTTATT
ATCTACACCC TCTGTTCCAA AATAAACCAA TTCCTTGCTA TGGATCTAGA GATAGCCTAT GTTCAGAGCT GTCCAGATCC
GTAGTCAGGA ATTGATTTAT TTTAGATGAA GAAGGGTTTG ATGGCATGCC TTTTTCTAAC CATGGTGGGG TCTCCATTGC
CTTGCAGATG AATGAGTCAT TCTTCACTGT GAGCTGGGCT TGCGACATTG ATGGCAATCC ATTGTTAGTA GCTGCAGGAA
GCACTGGAAT CATTCGAGTC ATCAACTGTG CCACTGAGAA GATATATAAG GTCTAGTAGT GCTAGTGCCA TTTTTTCTTC
TTTGCCACTA CTGCAACCTT GGATAAACTT TGCTCTGTAT CAGTCTATAT ATGTTTTTTT TTCAGTAATA TATGCCAAGC
TATGGTTCTG TTGCTTATAT ATTGGAAAAT AATTTCTTAT TTGATAGATT CTGATTTATC TGTGTTATCC ATTCCAGGAG
GTCACATGTA ATTCGCTTCG ATTAAGAACT ATAGCAATCT TTTGACTTTC TATATAGCTA CTAAATTGTG CCTTTTCTCT
TCTAAACATT TGTGGTTTCA GTGGGTCTTT AGCATGTCTA GTCAGAAAAT TGGCATATAA ATTATGAACC ATTCTATATC
AAGTACATAA CTGATGTGCG GCCAGTGTTT TATTTCTGTT TATGAAAAAT AAAATAAAAT TACAGAGTCT TGTTGGCCAT
GGTGGTTCAG TAAACGAAAT AAAGTCTCAA CCATCGAATC CTTCACTCAT CATTTCTGCA AGCAAGGTTA GAAGATTACA
TTGCCTAATC TGATATCTAC ATCTATTTCA TTTTTACTGA TGTTCTTTCA TACGGCATTG TGTAGGATGA ATCTATTAAG
CTGTGGAATG TGCAGACAGG GATCTTAATT TTGGTTTTTG GTGGAGTAGG AGGTCACCGA CACGAAGTAC TTGGTGTTGT
AAGTTGCTTA AGCTCCACTG TAGCATTTTT TATAAAAAAA ATTGTAATGC TACTAATTAA CTTGAAATTG TCCTTAAAAA
TAGGACTCAT CCAGCTTCTG ATGTCACTTT TTTTATTGAG CAGATTCAAT TTTATTCATT TCACCAGGAG TGAAATAATC
CTTAGTCACT GAAATTTTGC GCATTCTTTC TTTACATTAC GAGTGCAAAT ATTAATCATA ATTAATTAAT ATTATTGCTT
CAGGACTTCC ACACATCTGA TATCTACCGC TTTTTAAGTT GTGGAATGGA CAACACTGTG AGAATCTGGT CAATGAAAGG
TTAGTGAACC ATCTCATGAT AAAAAGAAAA GGCAATTGCA TGATGCTTAT CGGTGAAAGT GTGTGAATGC TGTAGAATTC
TGGGAATATG TTGAGAAATC CTATTCATGG ACTGATGCTA CATCAAAATT TCCAACAAAA TTTGTCCAAT TTCCGGTATG
CTTATAGTAT CTGCCAATCA TATCTGAATC TGTTCTTTAA TCTGTAATTT ATTAGTATGT ATAACCAATA TGGTATCATC
TCTCTCCTTT CAGGTCCTGT GTGCTGAAAT ACATTCTAAC TATGTAGACT GTACTAAATG GCTTGGGGAC TTTGTCCTGT
CAAAGGTAAA ATTGTTATTG CTCTTTTGAA GTCAATATTT ATAGTGCTTA CAAATTATTA TATCTTGGTT TTATCCTATT
CATAAAGGGC TATACATACT GAATTACTGA TACTGCAAAT TTCCAGGCTG TACCAGGAAC AGCCTTTTCA ATCATTAGAT
TAGTGTTACA GATTGGTTTT CCCATGACAA TTGGGTTACA AAAAGGACAA ATTCATTAGA GTAAAATTTT TATTACTCTT
TTGAAGCCAA TATTTCTAGT GCTTAAAAAA TTATTATACT GTGTTTTTAT GCTAGTCATA AAGGACAAAT TTATTTTCTA
CTGCTAGTGC AAGTTTTCCA ATCCTTAGAC TAGTGCTACA AATTGGGTTT TCTAGTGAAA ATTCGGTTAT TTCTGAAGGA
TGAATACATC TGATGTCTGC TAAACTTGAA TTTTCAGAGT GTTGAAAATG AAATCTTGCT GTGGGAATCG ATCACAAAAG
AAGAAAACCC TGGCGAGGTA ATATAATTTA ATTTATCTCT AGAATTACAA AATCTTACTC GTCTACTTAT ATCCAAACTA
ATCTGGCTAT GTTTATTTTC TTAAAGAAAC CATGTTACTT TCTTTCTCCA TGTCCCTATA CATACTACAA TACATACTAT
GTCTTCCTCT AAGGAAAATG GTTCTTTTGA TTTGTAGGGT CACATTGATG TTCTTCAGAA GTACCCTGTG CCAGAATGTA
ACATCTGGTT CATGAAATTC TCATGTGATT TTCACCACAA TCAGTTGGCA ATAGGTAATA ACTAATGTTG CACTGTTCTC
TCAAGAATCA TTTTTTTTGT AAGGCTTGAC GAATCATTTT GTTGTTATCG TTCTAAATTA TTACACAATA TACCTTTTTC
TTGGAAGACA ATGAATATGC TAGTATTTCT TTAGATAATG GATATGCAAT ATTGATTTTG ATATTCTTTA AAACAAAATG
TGAAGTGCTG AAGGATAACC ATGTGCTTAT TCAAACAGGA AACCGTGATG GTAAAGTCTA TGTCTGGAAA GTACAGACCA
GCCCTCCTGT TCTAATTGCT CGGTAATGTT AACCTCAAGA ACTCAACTTA TTAAGTTTCA TCGTCTGCAT TTAATTTGGT
ATATAGGTGT TGCCTGTTGG GTGTTAATTT CTACCAATTC TCATGTCTTC TACATGTGTG CTTATCATCA TCATGATCAT
CTACAGGCTC AATAATCCAC AAGTGAAATC AGCCATAAGG CAGACTGCAG TGTCCTTTGA TGGAAGGTAC ATTACTACAT
TCATCCTGTT CATACTATAA ATTTATCCCT GCTTATTCAT TCTGATGGAG CTAGCCTATC ATTTGCACTG TGTTTATGCT
TCTGTTTTAT TTTTTATTTT TGTTGTTTGT TTTCTTCTTG GAAGATTAAA AAAATGTTTT ATTGTGTTTC CATTTTCTTC
AGCACAATCC TTGCCTGCAC AGAGGATGGC AACATATGGC GTTGGGATGA AGTGGATCAC CCAACCGCCC CAGTCCCAAG
CAAGAAACAA AAGTGAAGCA AGGATTATAT TAATTGAAAT TAATAAGGCT GAATTGGCGA TTTGTTCTTG GTATACTTTG
TTATACTACT TTGCCTTAGC GTTCATCAAA ACTGCCATTT GATTTTCCAA CATTCAGAAA ACTCTATAGC TGGATGTAAG
ATTTATTATC GCAAGATATT CAGGATGTTG GTCGGTGACT TGGTTTTATC AATAATTTGC TGGGAATATA GTACTTAATC
T

Locus: Os08g0137250

Loading...

Locus: Os08g0137250

Loading...