Os08t0138200-00

Locus

Os08g0138200

Description

Similar to blue copper protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UCL27

CGSNL Gene Name

UCLACYANIN-LIKE PROTEIN 27

Oryzabase Gene Symbol Synonym(s)

OsUCL27

Oryzabase Gene Name Synonym(s)

uclacyanin-like protein 27

Transcript Evidence

ab initio prediction

Protein Evidence

NP_001060958.2 (RefSeq)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: copper ion binding (GO:0005507)

Molecular Function: electron carrier activity (GO:0009055)

Functional domain (InterPro)

Blue (type 1) copper domain (IPR000923)

Plastocyanin-like (IPR003245)

Cupredoxin (IPR008972)

Expression Databases

TENOR (Os08t0138200-00)

Others

Oryzabase (9776)

Transcript

573 bp

>Os08t0138200-00 Similar to blue copper protein.
ATGGCAGCATCAGCCAGAGCTCTCCTCGTCGTGGCCGTGGCGGCGGCGGCGGCGGTGCTC
GCGACGACGGCGATGGGCGCCACCACCTACACGGTGGGAGCACCGGCCGGGTCGTGGGAC
ACGCGCACCAACTACGCGCAGTGGGCGTCCGCCGCCACCTTCCGCGCCGGTGACCGGCTC
GTGTTCAGGTACTCGCCGGCGGCGCACGACGTCGTGGAGGTGACCAAGGCCGGCTACGAC
GCCTGCTCGGCGGCGAGCCCCATCGCCACCTTCAACTCCGGCGATGACACCGTCCCGCTC
GCCGCCGTTGGCACGCGGTACTTCATCTGCGGCTTCCCTGGACATTGCGCCGCCGGGATG
AAGCTCGCCGTCAAGGTCGAGGCCGCCGCCGCCGCCCCTGGCGGTAGTAGCACCACGCCG
TCGCCGTCGCCGTCGCCGGCGGCGTTGCCGCCGGTGAACGGTGGCCGGCCGGTGACGCCA
TCGAGCTCGGCGAGCAAGTCGGGTGGTGTTGTTGAGTCTCTTGTTGGTCTGGGCGTTGGC
GCCATGGCCGCTGGTCTCATGGTCTTTTATTAG

CDS

573 bp

>Os08t0138200-00 Similar to blue copper protein.
ATGGCAGCATCAGCCAGAGCTCTCCTCGTCGTGGCCGTGGCGGCGGCGGCGGCGGTGCTC
GCGACGACGGCGATGGGCGCCACCACCTACACGGTGGGAGCACCGGCCGGGTCGTGGGAC
ACGCGCACCAACTACGCGCAGTGGGCGTCCGCCGCCACCTTCCGCGCCGGTGACCGGCTC
GTGTTCAGGTACTCGCCGGCGGCGCACGACGTCGTGGAGGTGACCAAGGCCGGCTACGAC
GCCTGCTCGGCGGCGAGCCCCATCGCCACCTTCAACTCCGGCGATGACACCGTCCCGCTC
GCCGCCGTTGGCACGCGGTACTTCATCTGCGGCTTCCCTGGACATTGCGCCGCCGGGATG
AAGCTCGCCGTCAAGGTCGAGGCCGCCGCCGCCGCCCCTGGCGGTAGTAGCACCACGCCG
TCGCCGTCGCCGTCGCCGGCGGCGTTGCCGCCGGTGAACGGTGGCCGGCCGGTGACGCCA
TCGAGCTCGGCGAGCAAGTCGGGTGGTGTTGTTGAGTCTCTTGTTGGTCTGGGCGTTGGC
GCCATGGCCGCTGGTCTCATGGTCTTTTATTAG

Protein

191 aa

>Os08t0138200-00 Similar to blue copper protein.
MAASARALLVVAVAAAAAVLATTAMGATTYTVGAPAGSWDTRTNYAQWASAATFRAGDRL
VFRYSPAAHDVVEVTKAGYDACSAASPIATFNSGDDTVPLAAVGTRYFICGFPGHCAAGM
KLAVKVEAAAAAPGGSSTTPSPSPSPAALPPVNGGRPVTPSSSASKSGGVVESLVGLGVG
AMAAGLMVFY*

CDS

chr08:2140382..2140954 (+ strand) : 573 bp

FASTA

>Os08t0138200-00 class=Sequence position=chr08:2140382..2140954 (+ strand)
ATGGCAGCAT CAGCCAGAGC TCTCCTCGTC GTGGCCGTGG CGGCGGCGGC GGCGGTGCTC GCGACGACGG CGATGGGCGC
CACCACCTAC ACGGTGGGAG CACCGGCCGG GTCGTGGGAC ACGCGCACCA ACTACGCGCA GTGGGCGTCC GCCGCCACCT
TCCGCGCCGG TGACCGGCTC GTGTTCAGGT ACTCGCCGGC GGCGCACGAC GTCGTGGAGG TGACCAAGGC CGGCTACGAC
GCCTGCTCGG CGGCGAGCCC CATCGCCACC TTCAACTCCG GCGATGACAC CGTCCCGCTC GCCGCCGTTG GCACGCGGTA
CTTCATCTGC GGCTTCCCTG GACATTGCGC CGCCGGGATG AAGCTCGCCG TCAAGGTCGA GGCCGCCGCC GCCGCCCCTG
GCGGTAGTAG CACCACGCCG TCGCCGTCGC CGTCGCCGGC GGCGTTGCCG CCGGTGAACG GTGGCCGGCC GGTGACGCCA
TCGAGCTCGG CGAGCAAGTC GGGTGGTGTT GTTGAGTCTC TTGTTGGTCT GGGCGTTGGC GCCATGGCCG CTGGTCTCAT
GGTCTTTTAT TAG