Os08t0143400-01

Locus

Os08g0143400

Description

SWIRM and amine oxidase domain-containing protein, Homolog of Arabidopsis FLOWERING LOCUS D (FLD), Control of flowering time

RAP-DB Gene Symbol Synonym(s)

Hd18, OsHDMA703, HDMA703

RAP-DB Gene Name Synonym(s)

Heading date 18, SWIRM domain-containing protein HDMA703

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsHDMA703, HDMA703, OsPAO10, PAO10

Oryzabase Gene Name Synonym(s)

SWIRM domain-containing protein HDMA703, histone lysine-specific demethylase 703, polyamide oxidase 10

Transcript Evidence

AK120532

LC085838

Protein Evidence

Q6YYZ1

A0A146F8E4

Literature

PMID: 27318280

Note

Manual Curation

July 13, 2016

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein binding (GO:0005515)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Homeodomain-like (IPR009057)

SWIRM domain (IPR007526)

Winged helix-turn-helix DNA-binding domain (IPR011991)

FAD/NAD(P)-binding domain (IPR023753)

Amine oxidase (IPR002937)

Full-length cDNA

J013128B21 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0143400-01)

RiceXPro (AK120532)

Others

Oryzabase (12523)

KEGG (Os08t0143400-01 (EC:1.-.-.-))

Transcript

2719 bp

>Os08t0143400-01 SWIRM and amine oxidase domain-containing protein, Homolog of Arabidopsis FLOWERING LOCUS D (FLD), Control of flowering time
TCTCCCCTCGCCTCCGCGAAGCGAGAGAAACCCCAACCTCGTCGGCGGCGATGTCGTCGT
CGTCGCGGCGGCCGGCGAGGAGGGCGGCGTTGACGGCGAGGTCGTCGTACGACGAGTCGC
TGGTGGACGCCGAGCTGGAGTCCTACCTCGGGAACGCCAGGTCGCGGCGGATCAGCCGGC
TGCGCCGCCTCTCCGCCGACGAGCGGCAGCGGGAGACGGAGACGGAGGCGCTAATAGCGC
TCTCGCTGGGCTTCCCCATTGACGAGCTGCTCCCCGCCGAGCGGCCCCTCCTGCCGGCCC
CCGTCGCCGCCGCCCCCAACGACTACATCGTCGTCCGCAACCACATCCTCGCCTCGTGGC
GCGCCGACCCGCGGGTGCCGCTCCCGCGCTCGCGCGTGCAGGAGACCGTCGCCGCCAGCT
ACGACAACCTTGTCGCCGTGGCGCACGGGTTCCTCGCCCGGGAGGGCCACATCAACTTCG
GCGTCTCCGCCGCGTTCCCCGCCTCCCCACCACCCGATGCGCCGCAGCGCCTCGCCGCAT
CCGTGCTCGTCGTCGGCGCCGGTCTCGCCGGCCTCGCCGCCGCGCGCCAGCTGCTCCGAT
TCGGCCTCCGCGTGCTCGTCCTCGAGGGCCGCGCCCGCCCCGGCGGCCGCGTCTACACCA
CTCATCTCGGCGGGGACCAGGCCGCCGTTGAGCTCGGCGGCAGCGTCATCACCGGCATCC
ACACCAACCCGCTCGGCGTGCTCGCCAGGCAGCTCGGGATTCCACTCCACAAGGTGCGAG
ACAGTTGCCCGCTCTACCACCACGACGGCCGCACCGTGGACATGAAGCTGGACAGGAGCA
TGGATCTGGTGTTCAACACGCTTCTAGAACACGCCACCCGGCTGCGAGAGTATCTCAAGA
AGGCAGCCGAGGGGATCTCGCTAGGGGAAGGTATAGAGAGGCTGAGACGCTTTTACAAGG
TGGCGAAAAGCGTCGAGGAGAGGGAGGTTCTGGACTGGCATTTGGCTAACCTGGAATTCT
CCAATGCCGGCTGCCTATCGGAGCTCTCGCTCGCGCACTGGGACCAGGATGACCAGTATG
AGATGGGGGGAGACCATTGCTTCCTAGCCGGAGGGAATGCGAGGCTGGTACACGCATTGT
GCGATGGTGTGCCGGTGTTGTATGAGAAGACGGTGAAGCGGATTGAGCATGGGGAGGATG
GGGTGAGCATCACCGTGGAAGGAGGCCAGGTTTTCAAGGCTGACATGGCACTCTGCACTG
CTCCACTTGGAGTGCTCAAGAGCAGGAGCATCATTTTTGAACCGGAGTTGCCAGAGAGGA
AGCTTGAAGCAATCCAGAGGTTGGGGTTTGGGTTGTTGAACAAAGTCGCCATGGTGTTTC
CCCATGTATTTTGGGATGAGGAGATTGACACATTTGGGTGTTTGAATAAGGAGAGGAGCA
AGCGTGGCGAGTTCTTTCTCTTCTACAGCTACCACACTGTCTCTGGTGGTGCGGTACTTA
TCGCACTTGTTGCGGGAGAAGCTGCTTTGGAGTTTGAAAAGGTTGATCCTGCTGTAGCAC
TTCATAGGGTCCTTGGTATTCTTAAAGGTATCTATGGCCCCAAAGGTGTTACAGTGCCTG
ATCCCATTCAATCATGTTGCACAAGATGGGGTAGTGATCCTCTTTGCTCAGGTTCATACT
CTCACATCAGAGTTGGGTCTTCTGGCACTGACTATGATATTCTCGCTGAGAGCGTCAATG
ACCGGTTATTCTTTGCTGGAGAAGCAACAAATCGTGCATACCCTGCAACAATGCATGGAG
CTTTATTGAGTGGACTAAGGGAAGCTTCCAAGATTCTCCATGCTTCGGAAAGTAGATTGA
ATTCTGATTATAAGAAGTATGCCCTGCAGAAAAGCATCAGACTTATAAATAATGTACTGG
ACGACCTTTTCATGGAGCCAGATCTAGAATGTGGAAGATTCTCGTTCGTGTTCTCCTATA
TTACACCTGAGGAGGAACAGGCTCCGGGATTGGCTAGGATTACACTTGAGAAGCCTTTGC
TTCTGCCTTCCAAGAAACGCAAAGTAAAGGGTAATCAGAAGGATCAGGACCCTGTGGCTG
AGAAGATAGACCAAGAGGTGTTTTATTTATACGCCACCGTCTCGCAAGAGCAAGCAACTG
AACTATTGGAATGCGACAATGATAAAAGTAGGATAGCAGTTCTATGCAAAGATCTTGGTG
TTAAACTAATGGGTTACGACAGTACATACGATGTATGTAGTCATCTGATTTCTAGCATCT
CGAGAGCTCAGAAAGCCAGGAAAAGGTTGCAGGGACCGAAGAGCTTGAAAACCGGACTTT
GATCTGTACCGCTACTTTATTCTTGTTTGTAGAAAAGAACCCCATATTTTCTCTTTTGGT
TTGGGCCAAAAACTGGCTCATAGATTGTTCTCTAGTGTGCAAACTTTAGACGTGGGGCAG
GAAAACCAAGATCCTCCCTGCCATTTGTAACATGGCAGTCATCAGTCATCTGGCCTCCCT
CAGTAGATTAGAACTTAGATGCACTGATAAATTTCAATGAATAGTTTGGTTGCAGGTACT
ATTGGATTCTTTTAGGGAGGCTACTATTGTTTTCATCTTCCCCCTTTTTTTTCTAGATGT
TGTTCCTATATTGGTATCTGGCAGTTTATGTGTTGCTGAAATGGTGGATAAGCTCACTTC
TGGACCAGTTTGTTTGGCT

CDS

2292 bp

>Os08t0143400-01 SWIRM and amine oxidase domain-containing protein, Homolog of Arabidopsis FLOWERING LOCUS D (FLD), Control of flowering time
ATGTCGTCGTCGTCGCGGCGGCCGGCGAGGAGGGCGGCGTTGACGGCGAGGTCGTCGTAC
GACGAGTCGCTGGTGGACGCCGAGCTGGAGTCCTACCTCGGGAACGCCAGGTCGCGGCGG
ATCAGCCGGCTGCGCCGCCTCTCCGCCGACGAGCGGCAGCGGGAGACGGAGACGGAGGCG
CTAATAGCGCTCTCGCTGGGCTTCCCCATTGACGAGCTGCTCCCCGCCGAGCGGCCCCTC
CTGCCGGCCCCCGTCGCCGCCGCCCCCAACGACTACATCGTCGTCCGCAACCACATCCTC
GCCTCGTGGCGCGCCGACCCGCGGGTGCCGCTCCCGCGCTCGCGCGTGCAGGAGACCGTC
GCCGCCAGCTACGACAACCTTGTCGCCGTGGCGCACGGGTTCCTCGCCCGGGAGGGCCAC
ATCAACTTCGGCGTCTCCGCCGCGTTCCCCGCCTCCCCACCACCCGATGCGCCGCAGCGC
CTCGCCGCATCCGTGCTCGTCGTCGGCGCCGGTCTCGCCGGCCTCGCCGCCGCGCGCCAG
CTGCTCCGATTCGGCCTCCGCGTGCTCGTCCTCGAGGGCCGCGCCCGCCCCGGCGGCCGC
GTCTACACCACTCATCTCGGCGGGGACCAGGCCGCCGTTGAGCTCGGCGGCAGCGTCATC
ACCGGCATCCACACCAACCCGCTCGGCGTGCTCGCCAGGCAGCTCGGGATTCCACTCCAC
AAGGTGCGAGACAGTTGCCCGCTCTACCACCACGACGGCCGCACCGTGGACATGAAGCTG
GACAGGAGCATGGATCTGGTGTTCAACACGCTTCTAGAACACGCCACCCGGCTGCGAGAG
TATCTCAAGAAGGCAGCCGAGGGGATCTCGCTAGGGGAAGGTATAGAGAGGCTGAGACGC
TTTTACAAGGTGGCGAAAAGCGTCGAGGAGAGGGAGGTTCTGGACTGGCATTTGGCTAAC
CTGGAATTCTCCAATGCCGGCTGCCTATCGGAGCTCTCGCTCGCGCACTGGGACCAGGAT
GACCAGTATGAGATGGGGGGAGACCATTGCTTCCTAGCCGGAGGGAATGCGAGGCTGGTA
CACGCATTGTGCGATGGTGTGCCGGTGTTGTATGAGAAGACGGTGAAGCGGATTGAGCAT
GGGGAGGATGGGGTGAGCATCACCGTGGAAGGAGGCCAGGTTTTCAAGGCTGACATGGCA
CTCTGCACTGCTCCACTTGGAGTGCTCAAGAGCAGGAGCATCATTTTTGAACCGGAGTTG
CCAGAGAGGAAGCTTGAAGCAATCCAGAGGTTGGGGTTTGGGTTGTTGAACAAAGTCGCC
ATGGTGTTTCCCCATGTATTTTGGGATGAGGAGATTGACACATTTGGGTGTTTGAATAAG
GAGAGGAGCAAGCGTGGCGAGTTCTTTCTCTTCTACAGCTACCACACTGTCTCTGGTGGT
GCGGTACTTATCGCACTTGTTGCGGGAGAAGCTGCTTTGGAGTTTGAAAAGGTTGATCCT
GCTGTAGCACTTCATAGGGTCCTTGGTATTCTTAAAGGTATCTATGGCCCCAAAGGTGTT
ACAGTGCCTGATCCCATTCAATCATGTTGCACAAGATGGGGTAGTGATCCTCTTTGCTCA
GGTTCATACTCTCACATCAGAGTTGGGTCTTCTGGCACTGACTATGATATTCTCGCTGAG
AGCGTCAATGACCGGTTATTCTTTGCTGGAGAAGCAACAAATCGTGCATACCCTGCAACA
ATGCATGGAGCTTTATTGAGTGGACTAAGGGAAGCTTCCAAGATTCTCCATGCTTCGGAA
AGTAGATTGAATTCTGATTATAAGAAGTATGCCCTGCAGAAAAGCATCAGACTTATAAAT
AATGTACTGGACGACCTTTTCATGGAGCCAGATCTAGAATGTGGAAGATTCTCGTTCGTG
TTCTCCTATATTACACCTGAGGAGGAACAGGCTCCGGGATTGGCTAGGATTACACTTGAG
AAGCCTTTGCTTCTGCCTTCCAAGAAACGCAAAGTAAAGGGTAATCAGAAGGATCAGGAC
CCTGTGGCTGAGAAGATAGACCAAGAGGTGTTTTATTTATACGCCACCGTCTCGCAAGAG
CAAGCAACTGAACTATTGGAATGCGACAATGATAAAAGTAGGATAGCAGTTCTATGCAAA
GATCTTGGTGTTAAACTAATGGGTTACGACAGTACATACGATGTATGTAGTCATCTGATT
TCTAGCATCTCGAGAGCTCAGAAAGCCAGGAAAAGGTTGCAGGGACCGAAGAGCTTGAAA
ACCGGACTTTGA

Protein

764 aa

>Os08t0143400-01 SWIRM and amine oxidase domain-containing protein, Homolog of Arabidopsis FLOWERING LOCUS D (FLD), Control of flowering time
MSSSSRRPARRAALTARSSYDESLVDAELESYLGNARSRRISRLRRLSADERQRETETEA
LIALSLGFPIDELLPAERPLLPAPVAAAPNDYIVVRNHILASWRADPRVPLPRSRVQETV
AASYDNLVAVAHGFLAREGHINFGVSAAFPASPPPDAPQRLAASVLVVGAGLAGLAAARQ
LLRFGLRVLVLEGRARPGGRVYTTHLGGDQAAVELGGSVITGIHTNPLGVLARQLGIPLH
KVRDSCPLYHHDGRTVDMKLDRSMDLVFNTLLEHATRLREYLKKAAEGISLGEGIERLRR
FYKVAKSVEEREVLDWHLANLEFSNAGCLSELSLAHWDQDDQYEMGGDHCFLAGGNARLV
HALCDGVPVLYEKTVKRIEHGEDGVSITVEGGQVFKADMALCTAPLGVLKSRSIIFEPEL
PERKLEAIQRLGFGLLNKVAMVFPHVFWDEEIDTFGCLNKERSKRGEFFLFYSYHTVSGG
AVLIALVAGEAALEFEKVDPAVALHRVLGILKGIYGPKGVTVPDPIQSCCTRWGSDPLCS
GSYSHIRVGSSGTDYDILAESVNDRLFFAGEATNRAYPATMHGALLSGLREASKILHASE
SRLNSDYKKYALQKSIRLINNVLDDLFMEPDLECGRFSFVFSYITPEEEQAPGLARITLE
KPLLLPSKKRKVKGNQKDQDPVAEKIDQEVFYLYATVSQEQATELLECDNDKSRIAVLCK
DLGVKLMGYDSTYDVCSHLISSISRAQKARKRLQGPKSLKTGL*

5'UTR

chr08:2389227..2389276 (- strand) : 50 bp

CDS

chr08:2387690..2389226 (- strand) : 1537 bp

chr08:2385914..2386668 (- strand) : 755 bp

3'UTR

chr08:2385537..2385913 (- strand) : 377 bp

FASTA

>Os08t0143400-01 class=Sequence position=chr08:2385537..2389276 (- strand)
TCTCCCCTCG CCTCCGCGAA GCGAGAGAAA CCCCAACCTC GTCGGCGGCG ATGTCGTCGT CGTCGCGGCG GCCGGCGAGG
AGGGCGGCGT TGACGGCGAG GTCGTCGTAC GACGAGTCGC TGGTGGACGC CGAGCTGGAG TCCTACCTCG GGAACGCCAG
GTCGCGGCGG ATCAGCCGGC TGCGCCGCCT CTCCGCCGAC GAGCGGCAGC GGGAGACGGA GACGGAGGCG CTAATAGCGC
TCTCGCTGGG CTTCCCCATT GACGAGCTGC TCCCCGCCGA GCGGCCCCTC CTGCCGGCCC CCGTCGCCGC CGCCCCCAAC
GACTACATCG TCGTCCGCAA CCACATCCTC GCCTCGTGGC GCGCCGACCC GCGGGTGCCG CTCCCGCGCT CGCGCGTGCA
GGAGACCGTC GCCGCCAGCT ACGACAACCT TGTCGCCGTG GCGCACGGGT TCCTCGCCCG GGAGGGCCAC ATCAACTTCG
GCGTCTCCGC CGCGTTCCCC GCCTCCCCAC CACCCGATGC GCCGCAGCGC CTCGCCGCAT CCGTGCTCGT CGTCGGCGCC
GGTCTCGCCG GCCTCGCCGC CGCGCGCCAG CTGCTCCGAT TCGGCCTCCG CGTGCTCGTC CTCGAGGGCC GCGCCCGCCC
CGGCGGCCGC GTCTACACCA CTCATCTCGG CGGGGACCAG GCCGCCGTTG AGCTCGGCGG CAGCGTCATC ACCGGCATCC
ACACCAACCC GCTCGGCGTG CTCGCCAGGC AGCTCGGGAT TCCACTCCAC AAGGTGCGAG ACAGTTGCCC GCTCTACCAC
CACGACGGCC GCACCGTGGA CATGAAGCTG GACAGGAGCA TGGATCTGGT GTTCAACACG CTTCTAGAAC ACGCCACCCG
GCTGCGAGAG TATCTCAAGA AGGCAGCCGA GGGGATCTCG CTAGGGGAAG GTATAGAGAG GCTGAGACGC TTTTACAAGG
TGGCGAAAAG CGTCGAGGAG AGGGAGGTTC TGGACTGGCA TTTGGCTAAC CTGGAATTCT CCAATGCCGG CTGCCTATCG
GAGCTCTCGC TCGCGCACTG GGACCAGGAT GACCAGTATG AGATGGGGGG AGACCATTGC TTCCTAGCCG GAGGGAATGC
GAGGCTGGTA CACGCATTGT GCGATGGTGT GCCGGTGTTG TATGAGAAGA CGGTGAAGCG GATTGAGCAT GGGGAGGATG
GGGTGAGCAT CACCGTGGAA GGAGGCCAGG TTTTCAAGGC TGACATGGCA CTCTGCACTG CTCCACTTGG AGTGCTCAAG
AGCAGGAGCA TCATTTTTGA ACCGGAGTTG CCAGAGAGGA AGCTTGAAGC AATCCAGAGG TTGGGGTTTG GGTTGTTGAA
CAAAGTCGCC ATGGTGTTTC CCCATGTATT TTGGGATGAG GAGATTGACA CATTTGGGTG TTTGAATAAG GAGAGGAGCA
AGCGTGGCGA GTTCTTTCTC TTCTACAGCT ACCACACTGT CTCTGGTGGT GCGGTACTTA TCGCACTTGT TGCGGGAGAA
GCTGCTTTGG AGTTTGAAAA GGTTGATCCT GCTGTAGCAC TTCATAGGGT CCTTGGTATT CTTAAAGGTA ATCACTGAAC
TTACATTCCA ATGTATCTCC ATAAGACCAT ATTTTTTTGA AGTCTTCTAA CAAGGATGGA GTATGGATAA GCTTTAAGTA
TGAAGTATGA ACTCCTTGCA TATTAGAAAA TGGGGGAATG AATTATGGAA TGGCATAACA AGGTGTCACA TAAATTAAAG
AAAAAGAACA ATGTGTCATG TGTTGATTTA AGATTAGATT TAAATTTTGC TATGACAATC GGATTTGTTG TATTAATTCA
AGTAGTCCCT GCCATATGCA TTGGATGGTT GCATTAGAAC CATCAAGGGT ATATTTGGAA CCTAGTAGAG TCATGCCAAT
TCCATAATTT ATTGGAGTGC CATGTTGTGT TGATTTAACT TGAAGTGTTT ATACTAATAA TACAAGTCAA CAGCTCTGTA
AAAATTAACT CTGGATTGTG TACACTATCT GTGTACTGTC TTACCATCTA CAATCCTCAA CTAACCAGTA AATTTTATTA
TAGAGTTATT AATATGGATT GGAACTTGGA TGGTGTTTGA ACACTGAAGT GCTCCTTTTA GATTAAGAGT ATACAGATGG
AAAGAAGGAA TGGAAGGGAA GGAAATTATA TAATGAGATA TTTTAAAGAT TCTGTTACAA ATGCGATGAC TAGTACATTT
TTTCATTTAC TTTAGAGTTT AAATAAATAA AGAATATGCT ATTCTTTTGC ACTATATCAT ACTAGTTTGA TGTGCAGTGT
GCACCAATGT GCATATTGGA AGTCTATTGG CATAGTGGGG GCAAATAAAC TGTGTGATGA ATATGGAATG GTTTGCAAAT
AATGAAACAT CAGACAGAGT GAAACATGAT TTGGAGAATG TGAATTATTT CCATTATTAT CTTGTAATAT GAATTTGTGG
TTTGTAATGG AAAGGGTAAA AAAACAACTA GGAGAAATGT GCTTAGTTTC CAATATCTCA TTATATAATT TTTTTTTTTG
GTTTTCTATT TCAATAACCA ATGAACTCAC TTTTGTGACT TTTTCCAGGT ATCTATGGCC CCAAAGGTGT TACAGTGCCT
GATCCCATTC AATCATGTTG CACAAGATGG GGTAGTGATC CTCTTTGCTC AGGTTCATAC TCTCACATCA GAGTTGGGTC
TTCTGGCACT GACTATGATA TTCTCGCTGA GAGCGTCAAT GACCGGTTAT TCTTTGCTGG AGAAGCAACA AATCGTGCAT
ACCCTGCAAC AATGCATGGA GCTTTATTGA GTGGACTAAG GGAAGCTTCC AAGATTCTCC ATGCTTCGGA AAGTAGATTG
AATTCTGATT ATAAGAAGTA TGCCCTGCAG AAAAGCATCA GACTTATAAA TAATGTACTG GACGACCTTT TCATGGAGCC
AGATCTAGAA TGTGGAAGAT TCTCGTTCGT GTTCTCCTAT ATTACACCTG AGGAGGAACA GGCTCCGGGA TTGGCTAGGA
TTACACTTGA GAAGCCTTTG CTTCTGCCTT CCAAGAAACG CAAAGTAAAG GGTAATCAGA AGGATCAGGA CCCTGTGGCT
GAGAAGATAG ACCAAGAGGT GTTTTATTTA TACGCCACCG TCTCGCAAGA GCAAGCAACT GAACTATTGG AATGCGACAA
TGATAAAAGT AGGATAGCAG TTCTATGCAA AGATCTTGGT GTTAAACTAA TGGGTTACGA CAGTACATAC GATGTATGTA
GTCATCTGAT TTCTAGCATC TCGAGAGCTC AGAAAGCCAG GAAAAGGTTG CAGGGACCGA AGAGCTTGAA AACCGGACTT
TGATCTGTAC CGCTACTTTA TTCTTGTTTG TAGAAAAGAA CCCCATATTT TCTCTTTTGG TTTGGGCCAA AAACTGGCTC
ATAGATTGTT CTCTAGTGTG CAAACTTTAG ACGTGGGGCA GGAAAACCAA GATCCTCCCT GCCATTTGTA ACATGGCAGT
CATCAGTCAT CTGGCCTCCC TCAGTAGATT AGAACTTAGA TGCACTGATA AATTTCAATG AATAGTTTGG TTGCAGGTAC
TATTGGATTC TTTTAGGGAG GCTACTATTG TTTTCATCTT CCCCCTTTTT TTTCTAGATG TTGTTCCTAT ATTGGTATCT
GGCAGTTTAT GTGTTGCTGA AATGGTGGAT AAGCTCACTT CTGGACCAGT TTGTTTGGCT