Os08t0143400-02

Locus

Os08g0143400

Description

Similar to cDNA clone:J013128B21, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsHDMA703, HDMA703, OsPAO10, PAO10

Oryzabase Gene Name Synonym(s)

SWIRM domain-containing protein HDMA703, histone lysine-specific demethylase 703, polyamide oxidase 10

Transcript Evidence

AK066792 (DDBJ, Best hit)

Protein Evidence

B7F607 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Amine oxidase (IPR002937)

Full-length cDNA

J013079C13 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0143400-02)

RiceXPro (AK066792)

Others

Oryzabase (12523)

KEGG (Os08t0143400-02 (EC:1.-.-.-))

Transcript

2263 bp

>Os08t0143400-02 Similar to cDNA clone:J013128B21, full insert sequence.
GAGAAACCCCAACCTCGTCGGCGGCGATGTCGTCGTCGTCGCGGCGGCCGGCGAGGAGGG
CGGCGTTGACGGCGAGGTCGTCGTACGACGAGTCGCTGGTGGACGCCGAGCTGGAGTCCT
ACCTCGGGAACGCCAGGTCGCGGCGGATCAGCCGGCTGCGCCGCCTCTCCGCCGACGAGC
GGCAGCGGGAGACGGAGACGGAGGCGCTAATAGCGCTCTCGCTGGGCTTCCCCATTGACG
AGCTGCTCCCCGCCGAGCGGCCCCTCCTGCCGGCCCCCGTCGCCGCCGCCCCCAACGACT
ACATCGTCGTCCGCAACCACATCCTCGCCGGCCTCGCCGCCGCGCGCCAGCTGCTCCGAT
TCGGCCTCCGCGTGCTCGTCCTCGAGGGCCGCGCCCGCCCCGGCGGCCGCGTCTACACCA
CTCATCTCGGCGGGGACCAGGCCGCCGTTGAGCTCGGCGGCAGCGTCATCACCGGCATCC
ACACCAACCCGCTCGGCGTGCTCGCCAGGCAGCTCGGGATTCCACTCCACAAGGTGCGAG
ACAGTTGCCCGCTCTACCACCACGACGGCCGCACCGTGGACATGAAGCTGGACAGGAGCA
TGGATCTGGTGTTCAACACGCTTCTAGAACACGCCACCCGGCTGCGAGAGTATCTCAAGA
AGGCAGCCGAGGGGATCTCGCTAGGGGAAGGTATAGAGAGGCTGAGACGCTTTTACAAGG
TGGCGAAAAGCGTCGAGGAGAGGGAGGTTCTGGACTGGCATTTGGCTAACCTGGAATTCT
CCAATGCCGGCTGCCTATCGGAGCTCTCGCTCGCGCACTGGGACCAGGATGACCAGTATG
AGATGGGGGGAGACCATTGCTTCCTAGCCGGAGGGAATGCGAGGCTGGTACACGCATTGT
GCGATGGTGTGCCGGTGTTGTATGAGAAGACGGTGAAGCGGATTGAGCATGGGGAGGATG
GGGTGAGCATCACCGTGGAAGGAGGCCAGGTTTTCAAGGCTGACATGGCACTCTGCACTG
CTCCACTTGGAGTGCTCAAGAGCAGGAGCATCATTTTTGAACCGGAGTTGCCAGAGAGGA
AGCTTGAAGCAATCCAGAGGTTGGGGTTTGGGTTGTTGAACAAAGTCGCCATGGTGTTTC
CCCATGTATTTTGGGATGAGGAGATTGACACATTTGGGTGTTTGAATAAGGAGAGGAGCA
AGCGTGGCGAGTTCTTTCTCTTCTACAGCTACCACACTGTCTCTGGTGGTGCGGTACTTA
TCGCACTTGTTGCGGGAGAAGCTGCTTTGGAGTTTGAAAAGGTTGATCCTGCTGTAGCAC
TTCATAGGGTCCTTGGTATTCTTAAAGGTATCTATGGCCCCAAAGGTGTTACAGTGCCTG
ATCCCATTCAATCATGTTGCACAAGATGGGGTAGTGATCCTCTTTGCTCAGGTTCATACT
CTCACATCAGAGTTGGGTCTTCTGGCACTGACTATGATATTCTCGCTGAGAGCGTCAATG
ACCGGTTATTCTTTGCTGGAGAAGCAACAAATCGTGCATACCCTGCAACAATGCATGGAG
CTTTATTGAGTGGACTAAGGGAAGCTTCCAAGATTCTCCATGCTTCGGAAAGTAGATTGA
ATTCTGATTATAAGAAGTATGCCCTGCAGAAAAGCATCAGACTTATAAATAATGTACTGG
ACGACCTTTTCATGGAGCCAGATCTAGAATGTGGAAGATTCTCGTTCGTGTTCTCCTATA
TTACACCTGAGGAGGAACAGGCTCCGGGATTGGCTAGGATTACACTTGAGAAGCCTTTGC
TTCTGCCTTCCAAGAAACGCAAAGTAAAGGGTAATCAGAAGGATCAGGACCCTGTGGCTG
AGAAGATAGACCAAGAGGTGTTTTATTTATACGCCACCGTCTCGCAAGAGCAAGCAACTG
AACTATTGGAATGCGACAATGATAAAAGTAGGATAGCAGTTCTATGCAAAGATCTTGGTG
TTAAACTAATGGGTTACGACAGTACATACGATGTATGTAGTCATCTGATTTCTAGCATCT
CGAGAGCTCAGAAAGCCAGGAAAAGGTTGCAGGGACCGAAGAGCTTGAAAACCGGACTTT
GATCTGTACCGCTACTTTATTCTTGTTTGTAGAAAAGAACCCCATATTTTCTCTTTTGGT
TTGGGCCAAAAACTGGCTCATAGATTGTTCTCTAGTGTGCAAACTTTAGACGTGGGGCAG
GAAAACCAAGATCCTCCCTGCCATTTGTAACATGGCAGTCATC

CDS

2076 bp

>Os08t0143400-02 Similar to cDNA clone:J013128B21, full insert sequence.
ATGTCGTCGTCGTCGCGGCGGCCGGCGAGGAGGGCGGCGTTGACGGCGAGGTCGTCGTAC
GACGAGTCGCTGGTGGACGCCGAGCTGGAGTCCTACCTCGGGAACGCCAGGTCGCGGCGG
ATCAGCCGGCTGCGCCGCCTCTCCGCCGACGAGCGGCAGCGGGAGACGGAGACGGAGGCG
CTAATAGCGCTCTCGCTGGGCTTCCCCATTGACGAGCTGCTCCCCGCCGAGCGGCCCCTC
CTGCCGGCCCCCGTCGCCGCCGCCCCCAACGACTACATCGTCGTCCGCAACCACATCCTC
GCCGGCCTCGCCGCCGCGCGCCAGCTGCTCCGATTCGGCCTCCGCGTGCTCGTCCTCGAG
GGCCGCGCCCGCCCCGGCGGCCGCGTCTACACCACTCATCTCGGCGGGGACCAGGCCGCC
GTTGAGCTCGGCGGCAGCGTCATCACCGGCATCCACACCAACCCGCTCGGCGTGCTCGCC
AGGCAGCTCGGGATTCCACTCCACAAGGTGCGAGACAGTTGCCCGCTCTACCACCACGAC
GGCCGCACCGTGGACATGAAGCTGGACAGGAGCATGGATCTGGTGTTCAACACGCTTCTA
GAACACGCCACCCGGCTGCGAGAGTATCTCAAGAAGGCAGCCGAGGGGATCTCGCTAGGG
GAAGGTATAGAGAGGCTGAGACGCTTTTACAAGGTGGCGAAAAGCGTCGAGGAGAGGGAG
GTTCTGGACTGGCATTTGGCTAACCTGGAATTCTCCAATGCCGGCTGCCTATCGGAGCTC
TCGCTCGCGCACTGGGACCAGGATGACCAGTATGAGATGGGGGGAGACCATTGCTTCCTA
GCCGGAGGGAATGCGAGGCTGGTACACGCATTGTGCGATGGTGTGCCGGTGTTGTATGAG
AAGACGGTGAAGCGGATTGAGCATGGGGAGGATGGGGTGAGCATCACCGTGGAAGGAGGC
CAGGTTTTCAAGGCTGACATGGCACTCTGCACTGCTCCACTTGGAGTGCTCAAGAGCAGG
AGCATCATTTTTGAACCGGAGTTGCCAGAGAGGAAGCTTGAAGCAATCCAGAGGTTGGGG
TTTGGGTTGTTGAACAAAGTCGCCATGGTGTTTCCCCATGTATTTTGGGATGAGGAGATT
GACACATTTGGGTGTTTGAATAAGGAGAGGAGCAAGCGTGGCGAGTTCTTTCTCTTCTAC
AGCTACCACACTGTCTCTGGTGGTGCGGTACTTATCGCACTTGTTGCGGGAGAAGCTGCT
TTGGAGTTTGAAAAGGTTGATCCTGCTGTAGCACTTCATAGGGTCCTTGGTATTCTTAAA
GGTATCTATGGCCCCAAAGGTGTTACAGTGCCTGATCCCATTCAATCATGTTGCACAAGA
TGGGGTAGTGATCCTCTTTGCTCAGGTTCATACTCTCACATCAGAGTTGGGTCTTCTGGC
ACTGACTATGATATTCTCGCTGAGAGCGTCAATGACCGGTTATTCTTTGCTGGAGAAGCA
ACAAATCGTGCATACCCTGCAACAATGCATGGAGCTTTATTGAGTGGACTAAGGGAAGCT
TCCAAGATTCTCCATGCTTCGGAAAGTAGATTGAATTCTGATTATAAGAAGTATGCCCTG
CAGAAAAGCATCAGACTTATAAATAATGTACTGGACGACCTTTTCATGGAGCCAGATCTA
GAATGTGGAAGATTCTCGTTCGTGTTCTCCTATATTACACCTGAGGAGGAACAGGCTCCG
GGATTGGCTAGGATTACACTTGAGAAGCCTTTGCTTCTGCCTTCCAAGAAACGCAAAGTA
AAGGGTAATCAGAAGGATCAGGACCCTGTGGCTGAGAAGATAGACCAAGAGGTGTTTTAT
TTATACGCCACCGTCTCGCAAGAGCAAGCAACTGAACTATTGGAATGCGACAATGATAAA
AGTAGGATAGCAGTTCTATGCAAAGATCTTGGTGTTAAACTAATGGGTTACGACAGTACA
TACGATGTATGTAGTCATCTGATTTCTAGCATCTCGAGAGCTCAGAAAGCCAGGAAAAGG
TTGCAGGGACCGAAGAGCTTGAAAACCGGACTTTGA

Protein

692 aa

>Os08t0143400-02 Similar to cDNA clone:J013128B21, full insert sequence.
MSSSSRRPARRAALTARSSYDESLVDAELESYLGNARSRRISRLRRLSADERQRETETEA
LIALSLGFPIDELLPAERPLLPAPVAAAPNDYIVVRNHILAGLAAARQLLRFGLRVLVLE
GRARPGGRVYTTHLGGDQAAVELGGSVITGIHTNPLGVLARQLGIPLHKVRDSCPLYHHD
GRTVDMKLDRSMDLVFNTLLEHATRLREYLKKAAEGISLGEGIERLRRFYKVAKSVEERE
VLDWHLANLEFSNAGCLSELSLAHWDQDDQYEMGGDHCFLAGGNARLVHALCDGVPVLYE
KTVKRIEHGEDGVSITVEGGQVFKADMALCTAPLGVLKSRSIIFEPELPERKLEAIQRLG
FGLLNKVAMVFPHVFWDEEIDTFGCLNKERSKRGEFFLFYSYHTVSGGAVLIALVAGEAA
LEFEKVDPAVALHRVLGILKGIYGPKGVTVPDPIQSCCTRWGSDPLCSGSYSHIRVGSSG
TDYDILAESVNDRLFFAGEATNRAYPATMHGALLSGLREASKILHASESRLNSDYKKYAL
QKSIRLINNVLDDLFMEPDLECGRFSFVFSYITPEEEQAPGLARITLEKPLLLPSKKRKV
KGNQKDQDPVAEKIDQEVFYLYATVSQEQATELLECDNDKSRIAVLCKDLGVKLMGYDST
YDVCSHLISSISRAQKARKRLQGPKSLKTGL*

5'UTR

chr08:2389227..2389252 (- strand) : 26 bp

CDS

chr08:2388924..2389226 (- strand) : 303 bp

chr08:2387690..2388707 (- strand) : 1018 bp

chr08:2385914..2386668 (- strand) : 755 bp

3'UTR

chr08:2385753..2385913 (- strand) : 161 bp

FASTA

>Os08t0143400-02 class=Sequence position=chr08:2385753..2389252 (- strand)
GAGAAACCCC AACCTCGTCG GCGGCGATGT CGTCGTCGTC GCGGCGGCCG GCGAGGAGGG CGGCGTTGAC GGCGAGGTCG
TCGTACGACG AGTCGCTGGT GGACGCCGAG CTGGAGTCCT ACCTCGGGAA CGCCAGGTCG CGGCGGATCA GCCGGCTGCG
CCGCCTCTCC GCCGACGAGC GGCAGCGGGA GACGGAGACG GAGGCGCTAA TAGCGCTCTC GCTGGGCTTC CCCATTGACG
AGCTGCTCCC CGCCGAGCGG CCCCTCCTGC CGGCCCCCGT CGCCGCCGCC CCCAACGACT ACATCGTCGT CCGCAACCAC
ATCCTCGCCT CGTGGCGCGC CGACCCGCGG GTGCCGCTCC CGCGCTCGCG CGTGCAGGAG ACCGTCGCCG CCAGCTACGA
CAACCTTGTC GCCGTGGCGC ACGGGTTCCT CGCCCGGGAG GGCCACATCA ACTTCGGCGT CTCCGCCGCG TTCCCCGCCT
CCCCACCACC CGATGCGCCG CAGCGCCTCG CCGCATCCGT GCTCGTCGTC GGCGCCGGTC TCGCCGGCCT CGCCGCCGCG
CGCCAGCTGC TCCGATTCGG CCTCCGCGTG CTCGTCCTCG AGGGCCGCGC CCGCCCCGGC GGCCGCGTCT ACACCACTCA
TCTCGGCGGG GACCAGGCCG CCGTTGAGCT CGGCGGCAGC GTCATCACCG GCATCCACAC CAACCCGCTC GGCGTGCTCG
CCAGGCAGCT CGGGATTCCA CTCCACAAGG TGCGAGACAG TTGCCCGCTC TACCACCACG ACGGCCGCAC CGTGGACATG
AAGCTGGACA GGAGCATGGA TCTGGTGTTC AACACGCTTC TAGAACACGC CACCCGGCTG CGAGAGTATC TCAAGAAGGC
AGCCGAGGGG ATCTCGCTAG GGGAAGGTAT AGAGAGGCTG AGACGCTTTT ACAAGGTGGC GAAAAGCGTC GAGGAGAGGG
AGGTTCTGGA CTGGCATTTG GCTAACCTGG AATTCTCCAA TGCCGGCTGC CTATCGGAGC TCTCGCTCGC GCACTGGGAC
CAGGATGACC AGTATGAGAT GGGGGGAGAC CATTGCTTCC TAGCCGGAGG GAATGCGAGG CTGGTACACG CATTGTGCGA
TGGTGTGCCG GTGTTGTATG AGAAGACGGT GAAGCGGATT GAGCATGGGG AGGATGGGGT GAGCATCACC GTGGAAGGAG
GCCAGGTTTT CAAGGCTGAC ATGGCACTCT GCACTGCTCC ACTTGGAGTG CTCAAGAGCA GGAGCATCAT TTTTGAACCG
GAGTTGCCAG AGAGGAAGCT TGAAGCAATC CAGAGGTTGG GGTTTGGGTT GTTGAACAAA GTCGCCATGG TGTTTCCCCA
TGTATTTTGG GATGAGGAGA TTGACACATT TGGGTGTTTG AATAAGGAGA GGAGCAAGCG TGGCGAGTTC TTTCTCTTCT
ACAGCTACCA CACTGTCTCT GGTGGTGCGG TACTTATCGC ACTTGTTGCG GGAGAAGCTG CTTTGGAGTT TGAAAAGGTT
GATCCTGCTG TAGCACTTCA TAGGGTCCTT GGTATTCTTA AAGGTAATCA CTGAACTTAC ATTCCAATGT ATCTCCATAA
GACCATATTT TTTTGAAGTC TTCTAACAAG GATGGAGTAT GGATAAGCTT TAAGTATGAA GTATGAACTC CTTGCATATT
AGAAAATGGG GGAATGAATT ATGGAATGGC ATAACAAGGT GTCACATAAA TTAAAGAAAA AGAACAATGT GTCATGTGTT
GATTTAAGAT TAGATTTAAA TTTTGCTATG ACAATCGGAT TTGTTGTATT AATTCAAGTA GTCCCTGCCA TATGCATTGG
ATGGTTGCAT TAGAACCATC AAGGGTATAT TTGGAACCTA GTAGAGTCAT GCCAATTCCA TAATTTATTG GAGTGCCATG
TTGTGTTGAT TTAACTTGAA GTGTTTATAC TAATAATACA AGTCAACAGC TCTGTAAAAA TTAACTCTGG ATTGTGTACA
CTATCTGTGT ACTGTCTTAC CATCTACAAT CCTCAACTAA CCAGTAAATT TTATTATAGA GTTATTAATA TGGATTGGAA
CTTGGATGGT GTTTGAACAC TGAAGTGCTC CTTTTAGATT AAGAGTATAC AGATGGAAAG AAGGAATGGA AGGGAAGGAA
ATTATATAAT GAGATATTTT AAAGATTCTG TTACAAATGC GATGACTAGT ACATTTTTTC ATTTACTTTA GAGTTTAAAT
AAATAAAGAA TATGCTATTC TTTTGCACTA TATCATACTA GTTTGATGTG CAGTGTGCAC CAATGTGCAT ATTGGAAGTC
TATTGGCATA GTGGGGGCAA ATAAACTGTG TGATGAATAT GGAATGGTTT GCAAATAATG AAACATCAGA CAGAGTGAAA
CATGATTTGG AGAATGTGAA TTATTTCCAT TATTATCTTG TAATATGAAT TTGTGGTTTG TAATGGAAAG GGTAAAAAAA
CAACTAGGAG AAATGTGCTT AGTTTCCAAT ATCTCATTAT ATAATTTTTT TTTTTGGTTT TCTATTTCAA TAACCAATGA
ACTCACTTTT GTGACTTTTT CCAGGTATCT ATGGCCCCAA AGGTGTTACA GTGCCTGATC CCATTCAATC ATGTTGCACA
AGATGGGGTA GTGATCCTCT TTGCTCAGGT TCATACTCTC ACATCAGAGT TGGGTCTTCT GGCACTGACT ATGATATTCT
CGCTGAGAGC GTCAATGACC GGTTATTCTT TGCTGGAGAA GCAACAAATC GTGCATACCC TGCAACAATG CATGGAGCTT
TATTGAGTGG ACTAAGGGAA GCTTCCAAGA TTCTCCATGC TTCGGAAAGT AGATTGAATT CTGATTATAA GAAGTATGCC
CTGCAGAAAA GCATCAGACT TATAAATAAT GTACTGGACG ACCTTTTCAT GGAGCCAGAT CTAGAATGTG GAAGATTCTC
GTTCGTGTTC TCCTATATTA CACCTGAGGA GGAACAGGCT CCGGGATTGG CTAGGATTAC ACTTGAGAAG CCTTTGCTTC
TGCCTTCCAA GAAACGCAAA GTAAAGGGTA ATCAGAAGGA TCAGGACCCT GTGGCTGAGA AGATAGACCA AGAGGTGTTT
TATTTATACG CCACCGTCTC GCAAGAGCAA GCAACTGAAC TATTGGAATG CGACAATGAT AAAAGTAGGA TAGCAGTTCT
ATGCAAAGAT CTTGGTGTTA AACTAATGGG TTACGACAGT ACATACGATG TATGTAGTCA TCTGATTTCT AGCATCTCGA
GAGCTCAGAA AGCCAGGAAA AGGTTGCAGG GACCGAAGAG CTTGAAAACC GGACTTTGAT CTGTACCGCT ACTTTATTCT
TGTTTGTAGA AAAGAACCCC ATATTTTCTC TTTTGGTTTG GGCCAAAAAC TGGCTCATAG ATTGTTCTCT AGTGTGCAAA
CTTTAGACGT GGGGCAGGAA AACCAAGATC CTCCCTGCCA TTTGTAACAT GGCAGTCATC