Os08t0152100-01

Locus

Os08g0152100

Description

A member of the Nodulin26-like Intrinsic Protein (NIP) family, Arsenite transporter

RAP-DB Gene Symbol Synonym(s)

OsNIP3;3

RAP-DB Gene Name Synonym(s)

Nodulin26-like Intrinsic Protein 3;3

CGSNL Gene Symbol

NIP3;3

CGSNL Gene Name

NOD26 LIKE INTRINSIC PROTEIN 3;3

Oryzabase Gene Symbol Synonym(s)

OsNIP3;3, NIP3-3, OsNIP3.3, NIP3.3

Oryzabase Gene Name Synonym(s)

Aquaporin NIP3-3, NOD26-like intrinsic protein 3-3

Transcript Evidence

Inferred from literature

Protein Evidence

Q84S07

Literature

PMID: 29749629

Note

Manual Curation

May 18, 2018

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Molecular Function: channel activity (GO:0015267)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Aquaporin-like (IPR023271)

Major intrinsic protein (IPR000425)

Major intrinsic protein, conserved site (IPR022357)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Expression Databases

TENOR (Os08t0152100-00)

Others

Oryzabase (8525)

Transcript

837 bp

>Os08t0152100-01 A member of the Nodulin26-like Intrinsic Protein (NIP) family, Arsenite transporter
ATGGAAGGGCACAAGAGTGGCATGGAAGCTGTAGCAGTTGCCATCCCTCCCTTGCACACT
GGTGAGAGCAACCACAGGATTGACAGCAATGTCAGCTCGCAATGCCATGCTGATCCTGCA
GAGCTCTCTGATGAAACTCAGCAGCAATCTCTGTGGCATCTAGGCCTAAGAAAGATAATA
CCATCATCTGTTCCTCTCCTCAAGAAGGTCAGTGCTGAGTTCTTTGGCACATTCATACTG
ATCTTCACCGTGCTATCAACCATCATCATGGATGAACAACACAAAAGTATCGAGACGCTC
CTCGGAATCGCAACATCTGCAGGCTTAGCAGTCACTGTTCTAGTTCTGTCCCTCATCCAC
ATATCAGGATGCCATCTGAACCCTGCAATCAGCATCGCCATGGCCGTCTTTGGTCACCTC
CCTTCTGCTCATCTTCTACCTTACATTTCTTCACAAATTCTCGGGGCCGTCGCCGCCTCC
TTCGCCGTCAAAGGTCTGTATCATCCGGTGAACCCCGGGATTGTCACCGTGCCAAATGTC
GGCACGGTTGAGGCGTTTTTCGTCGAGTTCATAATAACATTTTTTCTACTGTTCATCATC
ACTGCTCTTGCCACTGATCCTAATGCAGTGAAAGAACTGATAGCAGTGGCAGTTGGGGCA
ACAGTCATGATGAACATTCTTGTGGCAGGGCCATCAACAGGAGCATCGATGAATCCGGCG
CGTACAATTGGCGCGGCTATTGCCACAGGGAGATATACTCAGATTTGGGTTTACTTGGTG
GCAACTCCACTGGGTGCTATAGCTGGAACTGGGGCTTATGTTGCAATTAAGCTGTAG

CDS

837 bp

>Os08t0152100-01 A member of the Nodulin26-like Intrinsic Protein (NIP) family, Arsenite transporter
ATGGAAGGGCACAAGAGTGGCATGGAAGCTGTAGCAGTTGCCATCCCTCCCTTGCACACT
GGTGAGAGCAACCACAGGATTGACAGCAATGTCAGCTCGCAATGCCATGCTGATCCTGCA
GAGCTCTCTGATGAAACTCAGCAGCAATCTCTGTGGCATCTAGGCCTAAGAAAGATAATA
CCATCATCTGTTCCTCTCCTCAAGAAGGTCAGTGCTGAGTTCTTTGGCACATTCATACTG
ATCTTCACCGTGCTATCAACCATCATCATGGATGAACAACACAAAAGTATCGAGACGCTC
CTCGGAATCGCAACATCTGCAGGCTTAGCAGTCACTGTTCTAGTTCTGTCCCTCATCCAC
ATATCAGGATGCCATCTGAACCCTGCAATCAGCATCGCCATGGCCGTCTTTGGTCACCTC
CCTTCTGCTCATCTTCTACCTTACATTTCTTCACAAATTCTCGGGGCCGTCGCCGCCTCC
TTCGCCGTCAAAGGTCTGTATCATCCGGTGAACCCCGGGATTGTCACCGTGCCAAATGTC
GGCACGGTTGAGGCGTTTTTCGTCGAGTTCATAATAACATTTTTTCTACTGTTCATCATC
ACTGCTCTTGCCACTGATCCTAATGCAGTGAAAGAACTGATAGCAGTGGCAGTTGGGGCA
ACAGTCATGATGAACATTCTTGTGGCAGGGCCATCAACAGGAGCATCGATGAATCCGGCG
CGTACAATTGGCGCGGCTATTGCCACAGGGAGATATACTCAGATTTGGGTTTACTTGGTG
GCAACTCCACTGGGTGCTATAGCTGGAACTGGGGCTTATGTTGCAATTAAGCTGTAG

Protein

279 aa

>Os08t0152100-01 A member of the Nodulin26-like Intrinsic Protein (NIP) family, Arsenite transporter
MEGHKSGMEAVAVAIPPLHTGESNHRIDSNVSSQCHADPAELSDETQQQSLWHLGLRKII
PSSVPLLKKVSAEFFGTFILIFTVLSTIIMDEQHKSIETLLGIATSAGLAVTVLVLSLIH
ISGCHLNPAISIAMAVFGHLPSAHLLPYISSQILGAVAASFAVKGLYHPVNPGIVTVPNV
GTVEAFFVEFIITFFLLFIITALATDPNAVKELIAVAVGATVMMNILVAGPSTGASMNPA
RTIGAAIATGRYTQIWVYLVATPLGAIAGTGAYVAIKL*

CDS

chr08:2997031..2997237 (+ strand) : 207 bp

chr08:2997610..2998029 (+ strand) : 420 bp

chr08:2998127..2998188 (+ strand) : 62 bp

chr08:2998310..2998457 (+ strand) : 148 bp

FASTA

>Os08t0152100-01 class=Sequence position=chr08:2997031..2998457 (+ strand)
ATGGAAGGGC ACAAGAGTGG CATGGAAGCT GTAGCAGTTG CCATCCCTCC CTTGCACACT GGTGAGAGCA ACCACAGGAT
TGACAGCAAT GTCAGCTCGC AATGCCATGC TGATCCTGCA GAGCTCTCTG ATGAAACTCA GCAGCAATCT CTGTGGCATC
TAGGCCTAAG AAAGATAATA CCATCATCTG TTCCTCTCCT CAAGAAGGTA CACACTTTTT TTACCCCATA TTTTCACCTc
tcatcgtctg ttttttgtct tatcagttgt gaccaaaatt tgaattttaa aatataattt tagagtaaat tttgaggttt
atttttcagt actgactttt aaactgctaa aaacataggt attataaaag ttttgcccat aaataatgtt tggttAAACG
TTGTTATAAA AGTTTATTTT TCCACACTTT ATTGGCCATA GATTAAACAA TAAGAGCAAA ATTCTTGAAC TTCCTCATCC
TCTTTCTCTT CTTCTTCAGA AAATGTACAG ATATCTGACA GACAACAACC TTTTTCCCCC GTAATCTTTT TCTTCAGATG
AATCTCTGAA ATGTTTCAGG TCAGTGCTGA GTTCTTTGGC ACATTCATAC TGATCTTCAC CGTGCTATCA ACCATCATCA
TGGATGAACA ACACAAAAGT ATCGAGACGC TCCTCGGAAT CGCAACATCT GCAGGCTTAG CAGTCACTGT TCTAGTTCTG
TCCCTCATCC ACATATCAGG ATGCCATCTG AACCCTGCAA TCAGCATCGC CATGGCCGTC TTTGGTCACC TCCCTTCTGC
TCATCTTCTA CCTTACATTT CTTCACAAAT TCTCGGGGCC GTCGCCGCCT CCTTCGCCGT CAAAGGTCTG TATCATCCGG
TGAACCCCGG GATTGTCACC GTGCCAAATG TCGGCACGGT TGAGGCGTTT TTCGTCGAGT TCATAATAAC ATTTTTTCTA
CTGTTCATCA TCACTGCTCT TGCCACTGAT CCTAATGCAG TAAGTGTGGT TTTCTGATGT ATTTTGATCA GTTTGGTTTT
CTTTTCTTTG AAATGTTTGA TTCAAATTTT GTCCTTTTGA TCAAAATCTT CATCAGGTGA AAGAACTGAT AGCAGTGGCA
GTTGGGGCAA CAGTCATGAT GAACATTCTT GTGGCAGGGT ATGTGCGTAT GGATTGATTA GGAACAATAC ATAGCTTTCC
TGGGTATTTT AAACTGTCAT GTAATACTAT TTGTGTTGTA TTTTACAAAA TATAATTTAG ATTTGAATAA TTTGAACAGG
CCATCAACAG GAGCATCGAT GAATCCGGCG CGTACAATTG GCGCGGCTAT TGCCACAGGG AGATATACTC AGATTTGGGT
TTACTTGGTG GCAACTCCAC TGGGTGCTAT AGCTGGAACT GGGGCTTATG TTGCAATTAA GCTGTAG

Locus: Os08g0152100

Loading...

Locus: Os08g0152100

Loading...