Os08t0157900-01

Locus

Os08g0157900

Description

Similar to NAM protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC37

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 37

Oryzabase Gene Symbol Synonym(s)

ONAC037, ONAC37, OsNTL2, NTL2

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 037, NAC domain-containing protein 37, NAC membrane-bound transcription factor 2, NAC MTF2

Transcript Evidence

AK065294 (DDBJ, Best hit)

Protein Evidence

B8BAW7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J013002N10 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0157900-01)

RiceXPro (AK065294)

Others

Oryzabase (11478)

KEGG (Os08t0157900-01)

Transcript

2828 bp

>Os08t0157900-01 Similar to NAM protein.
actccACCACCCCACGCTTCCTTCGCCGCTAAGTATATCCCTCCCGGCGACCGCGAATCG
GATCTTGAGAGTGAGAGAGAGGTTGGGggaggtggatgagagggcggagatgacggtgat
ggagctcaagaagctgccgctcgggttcaggttccaccccaccgacgaggagctcgtcag
gcactacctcaaggggaagatcacggggcagatcaggagcgaggccgatgtcatccccga
gatcgatgtctgcaagtgcgagccgtgggatctccctgATAAGTCTCTGATCCGCTCCGA
TGATCCGgagtggttcttcttcgcgccgaaggataggaagtatcccaatgggagcaggtc
gaacagggcgacggaggccgggtactggaaggccaccgggaaggacagggtgatcaggtc
caagggtgacaagaagaagcagcaagtaattggcatgaagaagacgctcgtgttccaccg
ggggcgtgcgccgaagggtgagcggactgggtggatcatgcatgagtaccgcACCACCGA
GCCGGAGTTTGAGTCCGGTGAGCAGGGAGGTTACGTTCTCTACCGGCTGTTCCGAAAGCA
AGAGGAGAAAATTGAGCGACCCAGTCCGGATGAAGTGGATAGAAGTGGATACTCACCCAC
TCCTTCTCGTTCAACTCCTGATAACATGGAACCAATTGAAGACGGAAATACACCATTAAA
CAGGGAATCTCCAGAATCTGCTCTGCATGAAAGCCCAATTGATTTGCCTGCTCTAACTGA
GGCTCAAGCTGCGCCAATTACAAGGTGGCTTGCAGACAGAACTGATAACGCGACAACAAA
TGAAGTAAACATCTCTCACATGCCTCATCATGGGCTTGATGGAGGAGCTAAGGCTAGCCC
TTCAGCTGGTGCTTTCCCTCAGCTGATTGGTTCACAACAGAATATCCATGATAATAATGA
ATTAGCCACAGTTTCTGCACCCATGCTACCACATGAAGACTTCAATAATTTCCCTCTAGG
AGCCATTGGTAATTTTGATGGCAATATGAATCCTCGAGATCCAGTGGAGGAGTTCTTGAA
TCAAACCATTGCTGATCCAGATGAGCATTCATCAACAACATCAAAGGCTCAGTATGATTC
GGACACTGGAATCATACCAACTGAGTTTGAGAACCATGGGGTGATGCAGGGTGAATTCAT
GGATGATCTGAGTGGGTTGGAAAATTTAGATTTCTGGCCAGATGACCGAAATCCCCAGTT
GAGTGCACTGTATGAGGACACACCATTGCTGCCTTATGATAGCACCGACCAGGATGTGCT
CTCCATGGACTCTGGTGCTGAATCCTTGCAAGATCTATTCAACAGCATGGACGATTCAAA
CGCGAGGAATAATGTATGGGGCAACGAACCATTCCTCCAGGGGACTGGATTTCCCATGTC
TTGGCCGTTACAGCCGAACTCCGCATTTCCAAACCAGGGCACTGCAAATAGGAGGCTCAT
GCTACAGCTATCAGAATCATTATCTCCTGATTTTGATGTGAGCATGACTAGAGATGAGTG
TGAAGATGAGGAACCAGGTATTGTTGTAACTTCGAAGTATGTGAATGAAGCTCCTGAGGA
GTCAACTGCAGAAAAGGATATGCCTTCTGATGGAGATGATGCTGAGCCAACGGGTATTAC
TATCCTGAGGCGACGCCATGCTCCAACTGCAAGTTCGTTTTCTGATGGAGATGATGCTGA
GTCAACGGGTATTACCATCCTAAGACAGCACCAAGCTCCAAATGCAAGCTTGCTTTCTGA
TGGAGATGATGCTGAGTCAACGGGTATCACTATCCTAAGACGACGCCAAGCTCCAACTGC
TAGCTCAGCTAGTTCATTTACTCAACAGGGTGCTGCAGTGCAAAGGGTGCGGCTACAATC
AAACCTTGATGCAGCACCGTGTTCTAGCGTTGATGGTTCATCAAGTTGCATCATAAATGA
AGGTGAAAGTGAACGCACCATGGAGAAACCTGAGATTGAAGAGAATGCAGGAAGTACCTT
GGCTGAAGGTGGGACTTGCCATGAGGATGACCAGAAGGAGCATGATGCTTCAGCAGCAAA
TGCTAAATCTGTTCTGAGGCTGCGGAAGACAGCAGAGGGAAGCGACAAGGAGAACAAGCA
GGAGGAAGAGGAGGGTGTTCTTGCTTCACATGTGAGAGCACCAGGGAATAAGAGGGGATT
CCCATCGTACATCATTTGGCTGGTTCTCTCTGTGGCTCTGGTCCTGCTTATCTCCCTTGG
GATTTATGGATGGGTGTAAACAGCTGCTCCCCTGATGGTCTTCAAGATGACCATGCTTAC
TGGCACAGGCTCCCAACATTGACCTGCTGTGCTGAGTGACCTGTTGTACATATTGCGTCT
TACGCCCTTGTGTTTAGACGGCGGTTGCTAGACACCCTGGAGTGTTTGTTCCCCTTCCAG
CGTGCTGCGGCAGAAGAAAAATCCAAAAACAAAAAAAAAAGAGGGGCGAAAACGAAGAAA
AAAGAAGAGGTAGTGAATGAGGAAAGTTGTTGTAGATGTTCTGTGACTTAGGTGCATGGT
AGTATTCCTTCCTGCTGTTATTGCAGATGTTAGTAGCCACATACCCTAGTTGTTCAGCAG
TTGTAAGTCAGGTTAGGGATATGGTTACTTTTGTCTATGTAATGTTCTGTAGCATTATCT
GAACCTGCTTTATCGGATGCAATTTCGTTTTCCTTTCAGTAAATCTCTGTGCTGCAAACT
GTAGTTCCTGTGTAAGTTTTGATGTGTGAAATGTTAATACTTCTAGTACTAATATACTAT
TGATGATG

CDS

2190 bp

>Os08t0157900-01 Similar to NAM protein.
atgacggtgatggagctcaagaagctgccgctcgggttcaggttccaccccaccgacgag
gagctcgtcaggcactacctcaaggggaagatcacggggcagatcaggagcgaggccgat
gtcatccccgagatcgatgtctgcaagtgcgagccgtgggatctccctgATAAGTCTCTG
ATCCGCTCCGATGATCCGgagtggttcttcttcgcgccgaaggataggaagtatcccaat
gggagcaggtcgaacagggcgacggaggccgggtactggaaggccaccgggaaggacagg
gtgatcaggtccaagggtgacaagaagaagcagcaagtaattggcatgaagaagacgctc
gtgttccaccgggggcgtgcgccgaagggtgagcggactgggtggatcatgcatgagtac
cgcACCACCGAGCCGGAGTTTGAGTCCGGTGAGCAGGGAGGTTACGTTCTCTACCGGCTG
TTCCGAAAGCAAGAGGAGAAAATTGAGCGACCCAGTCCGGATGAAGTGGATAGAAGTGGA
TACTCACCCACTCCTTCTCGTTCAACTCCTGATAACATGGAACCAATTGAAGACGGAAAT
ACACCATTAAACAGGGAATCTCCAGAATCTGCTCTGCATGAAAGCCCAATTGATTTGCCT
GCTCTAACTGAGGCTCAAGCTGCGCCAATTACAAGGTGGCTTGCAGACAGAACTGATAAC
GCGACAACAAATGAAGTAAACATCTCTCACATGCCTCATCATGGGCTTGATGGAGGAGCT
AAGGCTAGCCCTTCAGCTGGTGCTTTCCCTCAGCTGATTGGTTCACAACAGAATATCCAT
GATAATAATGAATTAGCCACAGTTTCTGCACCCATGCTACCACATGAAGACTTCAATAAT
TTCCCTCTAGGAGCCATTGGTAATTTTGATGGCAATATGAATCCTCGAGATCCAGTGGAG
GAGTTCTTGAATCAAACCATTGCTGATCCAGATGAGCATTCATCAACAACATCAAAGGCT
CAGTATGATTCGGACACTGGAATCATACCAACTGAGTTTGAGAACCATGGGGTGATGCAG
GGTGAATTCATGGATGATCTGAGTGGGTTGGAAAATTTAGATTTCTGGCCAGATGACCGA
AATCCCCAGTTGAGTGCACTGTATGAGGACACACCATTGCTGCCTTATGATAGCACCGAC
CAGGATGTGCTCTCCATGGACTCTGGTGCTGAATCCTTGCAAGATCTATTCAACAGCATG
GACGATTCAAACGCGAGGAATAATGTATGGGGCAACGAACCATTCCTCCAGGGGACTGGA
TTTCCCATGTCTTGGCCGTTACAGCCGAACTCCGCATTTCCAAACCAGGGCACTGCAAAT
AGGAGGCTCATGCTACAGCTATCAGAATCATTATCTCCTGATTTTGATGTGAGCATGACT
AGAGATGAGTGTGAAGATGAGGAACCAGGTATTGTTGTAACTTCGAAGTATGTGAATGAA
GCTCCTGAGGAGTCAACTGCAGAAAAGGATATGCCTTCTGATGGAGATGATGCTGAGCCA
ACGGGTATTACTATCCTGAGGCGACGCCATGCTCCAACTGCAAGTTCGTTTTCTGATGGA
GATGATGCTGAGTCAACGGGTATTACCATCCTAAGACAGCACCAAGCTCCAAATGCAAGC
TTGCTTTCTGATGGAGATGATGCTGAGTCAACGGGTATCACTATCCTAAGACGACGCCAA
GCTCCAACTGCTAGCTCAGCTAGTTCATTTACTCAACAGGGTGCTGCAGTGCAAAGGGTG
CGGCTACAATCAAACCTTGATGCAGCACCGTGTTCTAGCGTTGATGGTTCATCAAGTTGC
ATCATAAATGAAGGTGAAAGTGAACGCACCATGGAGAAACCTGAGATTGAAGAGAATGCA
GGAAGTACCTTGGCTGAAGGTGGGACTTGCCATGAGGATGACCAGAAGGAGCATGATGCT
TCAGCAGCAAATGCTAAATCTGTTCTGAGGCTGCGGAAGACAGCAGAGGGAAGCGACAAG
GAGAACAAGCAGGAGGAAGAGGAGGGTGTTCTTGCTTCACATGTGAGAGCACCAGGGAAT
AAGAGGGGATTCCCATCGTACATCATTTGGCTGGTTCTCTCTGTGGCTCTGGTCCTGCTT
ATCTCCCTTGGGATTTATGGATGGGTGTAA

Protein

730 aa

>Os08t0157900-01 Similar to NAM protein.
MTVMELKKLPLGFRFHPTDEELVRHYLKGKITGQIRSEADVIPEIDVCKCEPWDLPDKSL
IRSDDPEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIRSKGDKKKQQVIGMKKTL
VFHRGRAPKGERTGWIMHEYRTTEPEFESGEQGGYVLYRLFRKQEEKIERPSPDEVDRSG
YSPTPSRSTPDNMEPIEDGNTPLNRESPESALHESPIDLPALTEAQAAPITRWLADRTDN
ATTNEVNISHMPHHGLDGGAKASPSAGAFPQLIGSQQNIHDNNELATVSAPMLPHEDFNN
FPLGAIGNFDGNMNPRDPVEEFLNQTIADPDEHSSTTSKAQYDSDTGIIPTEFENHGVMQ
GEFMDDLSGLENLDFWPDDRNPQLSALYEDTPLLPYDSTDQDVLSMDSGAESLQDLFNSM
DDSNARNNVWGNEPFLQGTGFPMSWPLQPNSAFPNQGTANRRLMLQLSESLSPDFDVSMT
RDECEDEEPGIVVTSKYVNEAPEESTAEKDMPSDGDDAEPTGITILRRRHAPTASSFSDG
DDAESTGITILRQHQAPNASLLSDGDDAESTGITILRRRQAPTASSASSFTQQGAAVQRV
RLQSNLDAAPCSSVDGSSSCIINEGESERTMEKPEIEENAGSTLAEGGTCHEDDQKEHDA
SAANAKSVLRLRKTAEGSDKENKQEEEEGVLASHVRAPGNKRGFPSYIIWLVLSVALVLL
ISLGIYGWV*

5'UTR

chr08:3393241..3393349 (- strand) : 109 bp

CDS

chr08:3393072..3393240 (- strand) : 169 bp

chr08:3392104..3392390 (- strand) : 287 bp

chr08:3391519..3391845 (- strand) : 327 bp

chr08:3391092..3391388 (- strand) : 297 bp

chr08:3390183..3391007 (- strand) : 825 bp

chr08:3389862..3389931 (- strand) : 70 bp

chr08:3389559..3389773 (- strand) : 215 bp

3'UTR

chr08:3389030..3389558 (- strand) : 529 bp

FASTA

>Os08t0157900-01 class=Sequence position=chr08:3389030..3393349 (- strand)
actccACCAC CCCACGCTTC CTTCGCCGCT AAGTATATCC CTCCCGGCGA CCGCGAATCG GATCTTGAGA GTGAGAGAGA
GGTTGGGgga ggtggatgag agggcggaga tgacggtgat ggagctcaag aagctgccgc tcgggttcag gttccacccc
accgacgagg agctcgtcag gcactacctc aaggggaaga tcacggggca gatcaggagc gaggccgatg tcatccccga
gatcgatgtc tgcaagtgcg agccgtggga tctccctggt GAGTTTTCTT CTCCTTCCTC TCTGCTTTAG TCCTCCTTTT
GCTGCAGGGT TGGTTTGGAT TTCGTTGCTT GGGGTTATTT GTGCTGTTTT TTTTTGTCTC GATCGGGTGT GGTTTGCAGC
TGATTCCAGG TATGGAGAGC TTGGGGGTTG TGCTCGTTTG CGTGTTTTCG TTTTTGGTTT TATTCGTTTT GAAGAAATCA
CTCTGGTTTG CTCTTTCTTG TTTGGGTTTT GTTTCTTGCT TTTTTTGGTT TTTGGTTTTA TACCTGTAGC CGTGTGGTTT
TGGGGATTTT TTTTTGGTTT GATCACTACT GGGGTTTCCC CCATTTTTGG CCATTCTTTC AGTGATTCTT TTGTTTTTGT
TTATGCTGCT TTATTGCTGG ATCTCGGTGG TTTCTGGGCG GGATTCTGAT GAGCAGATTA CTGCTGCTTG CTGTGGTTTG
CATCTTTCTC CGTGAGGAAT TTTTTCTCCC CATGGGGATG CTAGTTTGAT GCGATTCCCT CGAACTCCGC TAAAAATGCC
TAAATCCTTT ATTAAAATGT GCCCGAGATG CTGTTTGGTG TGATGCGGTT CAAATCTTTG ACTTCGTTGA TGCAAATTTT
ACTAATCGAC CTGTCAAACT CTGAGAAAGA TTCCATTTCT GACGCGTGTT CCTCTTGATT TTGTGGCGGG TGCGTTCAGA
TAAGTCTCTG ATCCGCTCCG ATGATCCGga gtggttcttc ttcgcgccga aggataggaa gtatcccaat gggagcaggt
cgaacagggc gacggaggcc gggtactgga aggccaccgg gaaggacagg gtgatcaggt ccaagggtga caagaagaag
cagcaagtaa ttggcatgaa gaagacgctc gtgttccacc gggggcgtgc gccgaagggt gagcggactg ggtggatcat
gcatgagtac cgcACCACCG AGCCGGAGTT TGAGTCCGGT GAGCAGGTAT GCGATAGTGC TAGTACCTTG TTTTGTAGCT
TTCCTTTGTA GGTTTATTTT CTCAGCAAGT TCATGATCAG TATGTCAAGA TTTTTAGCGA CAATGTTGTT ATATATAGGT
ATGCTCACAG TTCACAGCTC GGTTGTGAGT TTACAGCAAA TGAGAATGTC AAATGAACAC TGCAAATATC TTTTGGGAAA
AAAAGAAACA TAATCATCTG ATGTTTCTGT TCTGGTATCT TAGTATTCGT ATTTGTATTT TCAGGGAGGT TACGTTCTCT
ACCGGCTGTT CCGAAAGCAA GAGGAGAAAA TTGAGCGACC CAGTCCGGAT GAAGTGGATA GAAGTGGATA CTCACCCACT
CCTTCTCGTT CAACTCCTGA TAACATGGAA CCAATTGAAG ACGGAAATAC ACCATTAAAC AGGGAATCTC CAGAATCTGC
TCTGCATGAA AGCCCAATTG ATTTGCCTGC TCTAACTGAG GCTCAAGCTG CGCCAATTAC AAGGTGGCTT GCAGACAGAA
CTGATAACGC GACAACAAAT GAAGTAAACA TCTCTCACAT GCCTCATCAT GGGCTTGATG GAGGAGCTAA GGTCAGTAAA
GTTGCTTGTA GGTCTATTAA ACTTGTATGA TCATTTTATA ATTGATTTAT TTCTCTAGCC AGTTAACTTC CTAGGTGTGA
ATTCCTTCTA ATTGTTTGCG TGATTCTTTT GATATAAGCA GGCTAGCCCT TCAGCTGGTG CTTTCCCTCA GCTGATTGGT
TCACAACAGA ATATCCATGA TAATAATGAA TTAGCCACAG TTTCTGCACC CATGCTACCA CATGAAGACT TCAATAATTT
CCCTCTAGGA GCCATTGGTA ATTTTGATGG CAATATGAAT CCTCGAGATC CAGTGGAGGA GTTCTTGAAT CAAACCATTG
CTGATCCAGA TGAGCATTCA TCAACAACAT CAAAGGCTCA GTATGATTCG GACACTGGAA TCATACCAAC TGAGTTTGAG
AACCATGGGG TGATGCAGGT AATGTTGTTC TCCCTAATCT GCACCTGCTG TTTAGGTTAT AGTTATTGTT TTTAATTCTT
ATTATCCATG GAACCTTTGC AGGGTGAATT CATGGATGAT CTGAGTGGGT TGGAAAATTT AGATTTCTGG CCAGATGACC
GAAATCCCCA GTTGAGTGCA CTGTATGAGG ACACACCATT GCTGCCTTAT GATAGCACCG ACCAGGATGT GCTCTCCATG
GACTCTGGTG CTGAATCCTT GCAAGATCTA TTCAACAGCA TGGACGATTC AAACGCGAGG AATAATGTAT GGGGCAACGA
ACCATTCCTC CAGGGGACTG GATTTCCCAT GTCTTGGCCG TTACAGCCGA ACTCCGCATT TCCAAACCAG GGCACTGCAA
ATAGGAGGCT CATGCTACAG CTATCAGAAT CATTATCTCC TGATTTTGAT GTGAGCATGA CTAGAGATGA GTGTGAAGAT
GAGGAACCAG GTATTGTTGT AACTTCGAAG TATGTGAATG AAGCTCCTGA GGAGTCAACT GCAGAAAAGG ATATGCCTTC
TGATGGAGAT GATGCTGAGC CAACGGGTAT TACTATCCTG AGGCGACGCC ATGCTCCAAC TGCAAGTTCG TTTTCTGATG
GAGATGATGC TGAGTCAACG GGTATTACCA TCCTAAGACA GCACCAAGCT CCAAATGCAA GCTTGCTTTC TGATGGAGAT
GATGCTGAGT CAACGGGTAT CACTATCCTA AGACGACGCC AAGCTCCAAC TGCTAGCTCA GCTAGTTCAT TTACTCAACA
GGGTGCTGCA GTGCAAAGGG TGCGGCTACA ATCAAACCTT GATGCAGCAC CGTGTTCTAG CGTTGATGGT TCATCAAGTT
GCATCATAAA TGAAGGTGAA AGTGAACGCA CCATGGAGAA ACCTGAGGTG AGTTATATTA CCCTTAAACT AATGCACTCT
TGTTCCATGG GAATAAGTTA AATCCTTTAT ATTCCATAGC CAGTTTGTTA TTAATTGTAC CAGAATGCAG GTAATTCCTT
TGTCATGAAC TACTAATGGA TCCTGGTTAA TTTCTTGTAA AAAATAAATA AAAGAACTCT AGGCTGATTA TGTACTGCAT
GCTTTGAAAG TTCTGTTGCT TTAGAAACGC TAATTTTCTC TTACGTTGTT CTTGCCAGAT TGAAGAGAAT GCAGGAAGTA
CCTTGGCTGA AGGTGGGACT TGCCATGAGG ATGACCAGAA GGAGCATGGT AATACCACTT TTGAAATATT TCATCCAGAA
AATTTGTGAT TTACCGTTCC TTCTCTCGTA AGCTAATCTG ATATATTGAC ATGTAGATGC TTCAGCAGCA AATGCTAAAT
CTGTTCTGAG GCTGCGGAAG ACAGCAGAGG GAAGCGACAA GGAGAACAAG CAGGAGGAAG AGGAGGGTGT TCTTGCTTCA
CATGTGAGAG CACCAGGGAA TAAGAGGGGA TTCCCATCGT ACATCATTTG GCTGGTTCTC TCTGTGGCTC TGGTCCTGCT
TATCTCCCTT GGGATTTATG GATGGGTGTA AACAGCTGCT CCCCTGATGG TCTTCAAGAT GACCATGCTT ACTGGCACAG
GCTCCCAACA TTGACCTGCT GTGCTGAGTG ACCTGTTGTA CATATTGCGT CTTACGCCCT TGTGTTTAGA CGGCGGTTGC
TAGACACCCT GGAGTGTTTG TTCCCCTTCC AGCGTGCTGC GGCAGAAGAA AAATCCAAAA ACAAAAAAAA AAGAGGGGCG
AAAACGAAGA AAAAAGAAGA GGTAGTGAAT GAGGAAAGTT GTTGTAGATG TTCTGTGACT TAGGTGCATG GTAGTATTCC
TTCCTGCTGT TATTGCAGAT GTTAGTAGCC ACATACCCTA GTTGTTCAGC AGTTGTAAGT CAGGTTAGGG ATATGGTTAC
TTTTGTCTAT GTAATGTTCT GTAGCATTAT CTGAACCTGC TTTATCGGAT GCAATTTCGT TTTCCTTTCA GTAAATCTCT
GTGCTGCAAA CTGTAGTTCC TGTGTAAGTT TTGATGTGTG AAATGTTAAT ACTTCTAGTA CTAATATACT ATTGATGATG