Os08t0159800-00

Locus

Os08g0159800

Description

Zinc finger, CCCH-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

C3H56

CGSNL Gene Name

ZINC FINGER CCCH DOMAIN-CONTAINING PROTEIN 56

Oryzabase Gene Symbol Synonym(s)

OsC3H56

Oryzabase Gene Name Synonym(s)

Zinc finger CCCH domain-containing protein 56

Transcript Evidence

FP098377 (DDBJ)

Protein Evidence

NP_001061044.1 (RefSeq)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleic acid binding (GO:0003676)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, CCCH-type (IPR000571)

Expression Databases

TENOR (Os08t0159800-00)

Others

Oryzabase (8622)

Transcript

1648 bp

>Os08t0159800-00 Zinc finger, CCCH-type domain containing protein.
TACATCCCATCTCTTCCCCTCTCCTCAACTCATCTCCTCCGGCGGATTACCGCTGCCGCC
TTCGCCGCCGGCGCCGCCGTTCGCCATCACCGAGCAAGCAAGTGACCTCGCTGTTCGTCT
CTCCCACCTCCTCCTTCTTCCGCTGCCTTCGATTCTTGGTAAGCCCCTAATTCTCCTTCG
ATTCAATCCTCAATCGGGGGAAGATGAAGCCTGTGATTCTTGCAGGTAGCGGGTGATGGA
TTACACCAACGCCATCCACATCATCCCGGACGCGGCGGGCCCCGACGCCTGGGCGAACGC
GGCGGCGCAGGGCGGGGACGCCGGGATATGGGCCACCGAGGACGACTACAACAGCCAGTG
GAACGCCGACGGCGGCGGCGGCGGCTCCTCGAGGGCCGGGAGCGAGCAGCCACCTCCGGG
CAAGAAATCCCGCGGCGGCGGCGGCGGCGAAGGCGGCGGGAACACGAGCAAGTCGCGGGC
GATCGGGAAGATGTTCTTCAAGACGAAGCTGTGCTGCAAGTTCAGGGCGGGGACCTGCCC
CTACGTCACCAACTGCAACTTCGCCCACGGCATGGAGGAGCTCCGCAAGCCGCCGCCCAA
CTGGCAGGAGATCGTCGCGGCGCACGAGGAGGCCACGGAGGCGAGGGAGGAGCACCAGAT
CCCCATCATGACGTCGTCGGGACCCACCGCCGGCGGCGACGCGGGCTGCGGCGGCGGCGG
CGGCGGCGGCTCCGGGAGGGCCTACAAGGGGAGGCACTGCAAGAAGTTCTACACCGACGA
GGGATGCCCCTACGGCGACGCGTGCACGTTCCTCCACGACGAGCAGTCCAAGGCCAGGGA
GAGCGTCGCGATCAGCCTCTCGCCGAGCGTCGGCGGCGGCGGCGGTGGCGGGAGCTACAA
TTCTGCGGCCGCCGCGGCCGCCTCCGCCTCCGCCGCGGCGGGGAATGGGCCGATGCAGAA
GCCGTCGAACTGGAAGACGAGGATCTGTAACAAGTGGGAGATGACTGGGTACTGCCCCTT
TGGCAGCAAATGCCACTTCGCTCATGGAGCAGCTGAACTCCACAAGTATGGTGGGGGACT
TGTTGACATAGACAGCAGGGATGCTGCAGCAACTCCCGACTCCAAGCAAGCTGTGGTATC
TGCGAAAGCTCCAGCAGAGACCGCTGCTGCATCCACCACAGTGCTCCCTCATGCAGACGT
GTACCATCTAGGCGTGCAGGCGCAGCGTTCTACCATTGCCGGCCAAAGGTCTGGGCAGGT
ACAGAGGCCCATTCAGAAATGGAAGGGCCCTGACAAGATCAGCAGGATCTATGGTGACTG
GATAGACGAAACCGAGTAGGCGAAATCAAACCTTTGATCTTTCGTCGCCACCACCTGAAG
GCGAAAACAAGATGCTATAGTTAGCCATTGGGAAAAACCATTCCATGTGGAAACCTGGTC
AGAGTCAAGACATAGTCTGCGGGTTGTTAGACTGAATTTTATGTTGTGCTGTCTGTTGCA
ATACCTGATATCATGTATGGTGCTTACATGATATGAAGTCATGGTTGCAATACCTGTACC
TGGAAAGTTAGATATGGTTATCTGAAAGTATGAACTGCCTGTTTACCTGTCATCTGTTGT
TTTTCTGCTTTGGCTGTCACTTGTGCTA

CDS

1104 bp

>Os08t0159800-00 Zinc finger, CCCH-type domain containing protein.
ATGGATTACACCAACGCCATCCACATCATCCCGGACGCGGCGGGCCCCGACGCCTGGGCG
AACGCGGCGGCGCAGGGCGGGGACGCCGGGATATGGGCCACCGAGGACGACTACAACAGC
CAGTGGAACGCCGACGGCGGCGGCGGCGGCTCCTCGAGGGCCGGGAGCGAGCAGCCACCT
CCGGGCAAGAAATCCCGCGGCGGCGGCGGCGGCGAAGGCGGCGGGAACACGAGCAAGTCG
CGGGCGATCGGGAAGATGTTCTTCAAGACGAAGCTGTGCTGCAAGTTCAGGGCGGGGACC
TGCCCCTACGTCACCAACTGCAACTTCGCCCACGGCATGGAGGAGCTCCGCAAGCCGCCG
CCCAACTGGCAGGAGATCGTCGCGGCGCACGAGGAGGCCACGGAGGCGAGGGAGGAGCAC
CAGATCCCCATCATGACGTCGTCGGGACCCACCGCCGGCGGCGACGCGGGCTGCGGCGGC
GGCGGCGGCGGCGGCTCCGGGAGGGCCTACAAGGGGAGGCACTGCAAGAAGTTCTACACC
GACGAGGGATGCCCCTACGGCGACGCGTGCACGTTCCTCCACGACGAGCAGTCCAAGGCC
AGGGAGAGCGTCGCGATCAGCCTCTCGCCGAGCGTCGGCGGCGGCGGCGGTGGCGGGAGC
TACAATTCTGCGGCCGCCGCGGCCGCCTCCGCCTCCGCCGCGGCGGGGAATGGGCCGATG
CAGAAGCCGTCGAACTGGAAGACGAGGATCTGTAACAAGTGGGAGATGACTGGGTACTGC
CCCTTTGGCAGCAAATGCCACTTCGCTCATGGAGCAGCTGAACTCCACAAGTATGGTGGG
GGACTTGTTGACATAGACAGCAGGGATGCTGCAGCAACTCCCGACTCCAAGCAAGCTGTG
GTATCTGCGAAAGCTCCAGCAGAGACCGCTGCTGCATCCACCACAGTGCTCCCTCATGCA
GACGTGTACCATCTAGGCGTGCAGGCGCAGCGTTCTACCATTGCCGGCCAAAGGTCTGGG
CAGGTACAGAGGCCCATTCAGAAATGGAAGGGCCCTGACAAGATCAGCAGGATCTATGGT
GACTGGATAGACGAAACCGAGTAG

Protein

367 aa

>Os08t0159800-00 Zinc finger, CCCH-type domain containing protein.
MDYTNAIHIIPDAAGPDAWANAAAQGGDAGIWATEDDYNSQWNADGGGGGSSRAGSEQPP
PGKKSRGGGGGEGGGNTSKSRAIGKMFFKTKLCCKFRAGTCPYVTNCNFAHGMEELRKPP
PNWQEIVAAHEEATEAREEHQIPIMTSSGPTAGGDAGCGGGGGGGSGRAYKGRHCKKFYT
DEGCPYGDACTFLHDEQSKARESVAISLSPSVGGGGGGGSYNSAAAAAASASAAAGNGPM
QKPSNWKTRICNKWEMTGYCPFGSKCHFAHGAAELHKYGGGLVDIDSRDAAATPDSKQAV
VSAKAPAETAAASTTVLPHADVYHLGVQAQRSTIAGQRSGQVQRPIQKWKGPDKISRIYG
DWIDETE*

5'UTR

chr08:3512008..3512242 (- strand) : 235 bp

CDS

chr08:3511188..3512007 (- strand) : 820 bp

chr08:3509094..3509377 (- strand) : 284 bp

3'UTR

chr08:3509011..3509093 (- strand) : 83 bp

chr08:3508715..3508940 (- strand) : 226 bp

FASTA

>Os08t0159800-00 class=Sequence position=chr08:3508715..3512242 (- strand)
TACATCCCAT CTCTTCCCCT CTCCTCAACT CATCTCCTCC GGCGGATTAC CGCTGCCGCC TTCGCCGCCG GCGCCGCCGT
TCGCCATCAC CGAGCAAGCA AGTGACCTCG CTGTTCGTCT CTCCCACCTC CTCCTTCTTC CGCTGCCTTC GATTCTTGGT
AAGCCCCTAA TTCTCCTTCG ATTCAATCCT CAATCGGGGG AAGATGAAGC CTGTGATTCT TGCAGGTAGC GGGTGATGGA
TTACACCAAC GCCATCCACA TCATCCCGGA CGCGGCGGGC CCCGACGCCT GGGCGAACGC GGCGGCGCAG GGCGGGGACG
CCGGGATATG GGCCACCGAG GACGACTACA ACAGCCAGTG GAACGCCGAC GGCGGCGGCG GCGGCTCCTC GAGGGCCGGG
AGCGAGCAGC CACCTCCGGG CAAGAAATCC CGCGGCGGCG GCGGCGGCGA AGGCGGCGGG AACACGAGCA AGTCGCGGGC
GATCGGGAAG ATGTTCTTCA AGACGAAGCT GTGCTGCAAG TTCAGGGCGG GGACCTGCCC CTACGTCACC AACTGCAACT
TCGCCCACGG CATGGAGGAG CTCCGCAAGC CGCCGCCCAA CTGGCAGGAG ATCGTCGCGG CGCACGAGGA GGCCACGGAG
GCGAGGGAGG AGCACCAGAT CCCCATCATG ACGTCGTCGG GACCCACCGC CGGCGGCGAC GCGGGCTGCG GCGGCGGCGG
CGGCGGCGGC TCCGGGAGGG CCTACAAGGG GAGGCACTGC AAGAAGTTCT ACACCGACGA GGGATGCCCC TACGGCGACG
CGTGCACGTT CCTCCACGAC GAGCAGTCCA AGGCCAGGGA GAGCGTCGCG ATCAGCCTCT CGCCGAGCGT CGGCGGCGGC
GGCGGTGGCG GGAGCTACAA TTCTGCGGCC GCCGCGGCCG CCTCCGCCTC CGCCGCGGCG GGGAATGGGC CGATGCAGAA
GCCGTCGAAC TGGAAGACGA GGATCTGTAA CAAGTGGGAG ATGACTGGGT ACTGCCCCTT TGGCAGCAAA TGCCACTTCG
CTCATGGAGC AGCTGGTGAG TTTGCTTGTT TCATAGTATG CATTTGTCAA ATTCTTGAAT TGTTATATGT TACCCTGTGT
TTTTAGAGAT AATTTAGCCT ATTGTGATTT GTTCTACGGT TGAATATGTA GTTATTGAAT CTGTAGTTAG TGTGTGGATG
GTGCTTCGTT TCATTTTCGG TAGACCATAA TGTGCGATGA ACTTATCAAT CTTCATTTGA TCTGTGACCT TGTTTCATCA
GAGATTTAGT TTGATTGGAC ATAAAACCTC ACTTGTGCCC TGATAGCTGT GACAATTCTA GGTATTAACA ATTGTTTCTC
TGATATACAT CAGGGCTGTG TTGTTTTAGT TATTTACTAG TACATTGCAT CACAGCTCTA CCTTGAAATC TTGTTTTATT
CATCAAGTAT ATAGCACACC TTTAGGACAG GAATATATCC TTCCCAACAT ATTTACTGAA CTATACAACA AATCTATTCC
TAAATCTATT CTTTTTGAGA CTATGAGTGA GGCCATGTAT TCTATATGGA TTATGAAGCA CAACATTGAT GGTGGGTCTA
GTGTTGGCTT CAGCGCATAT CAAGTATTCA GAAGTTCCCA GTGTGATGGT ATTGTGATCG TTCAAAACTT AGATCGTTCT
AGCTTATTGT TTCTTCAACT TAAATGAATA TGCATGTCAT TGTCCCAGTG AAGCTTCTGC GCTGTGCTGG TGAAACACAT
CTTTGTACTT CAAGCTGTGA ATCGCGATAA CATTTACAAT TTTCTCATAG GTCATGTTTG TTGGATCATC TTGTAGTGTA
GGTATTTTCT GAACTTTTCA CGGTCGACCT GTTACCACTG CACAATATAT AGGTTTCAGT CCACTTCACC ACTTGTTTAT
AGATGAGTGA CCAGTCTTTG TACCTATATT ATTATCCTCT TTGTACAACA TTTGCTGCCA GATACAGGCA ACTCCTTGAT
GTCTTGAATC TTGGTCATTG CTCAGAGTAG AAAGGCATTC TAGAGTTAAG CGCACAATAC GATCATGGCT ACTAAGAGCA
CAGTAGCATA CATGTTCTTT AAGTGACCAT CACATTATTT AGTCGCTTAT ATTCCTAGGA TGAGAACACT ATGATGATAT
CTGAATTTGA AGAGGGAAGT CCTGGCTTGA CAGGTTACAT TTGCTCTTCA GGAGCCTCTA CTAAATTCTA GATTCAATTA
TCAGTGTCAC CGTTTATCTT GTGCAGTTTA GGAATATTTC TGCTTTTATT AGTCATTTGC AGTTTACATG TTGATCTGAG
TCTAATTCAC TTATTAGCCT GTTTAGTTTA AGTGTTGGCT TCAAAAAGAA ATTTCTTAGA TTTAGTCAGA ATGAAATGCT
GGTTTAGTGA CCATATCTGT TGCTAGTTTC TACCCACTTA ACTTTGTTTT AAGGGTTTGC TTTCTGTTGC GTCAGGGTTA
CATGTGGACA GTTAGTTTTT TTTCCCCATT TGCACATTTT TATCTTGCAT GATGTTCTCC ATTTCTTCTT TAGTACAAGA
TTGGAGTATT CACTAAAACT GAAATATGCA GTAGAAACAC TGAAAGAGGT GGTCATTTTT AGCCTGATGC ATTCCTACTG
GATGTTGACT ATATTTATGA GCTATTGACA GTTTGCAGAT TTACAGAATA CAATTTGTTC TGTTATGTAT ATATCTTTCT
CCTACATTTT AAATCACCTT TGAGAATCTT TAGATAAACT TATTGCAATT TAGTCCTGTT AATTGAAATG TTTCATTTGT
CATTTAATTG AGGCAGCAAA AACCCCACCT GATGTATCTT ACATTTTTCA TGAATTTCAT TTCAGAACTC CACAAGTATG
GTGGGGGACT TGTTGACATA GACAGCAGGG ATGCTGCAGC AACTCCCGAC TCCAAGCAAG CTGTGGTATC TGCGAAAGCT
CCAGCAGAGA CCGCTGCTGC ATCCACCACA GTGCTCCCTC ATGCAGACGT GTACCATCTA GGCGTGCAGG CGCAGCGTTC
TACCATTGCC GGCCAAAGGT CTGGGCAGGT ACAGAGGCCC ATTCAGAAAT GGAAGGGCCC TGACAAGATC AGCAGGATCT
ATGGTGACTG GATAGACGAA ACCGAGTAGG CGAAATCAAA CCTTTGATCT TTCGTCGCCA CCACCTGAAG GCGAAAACAA
GATGCTATAG TTAGCCATTG GGAAAAACCA TTGTCTTGAG CGAAAAGGAG ATGTCAATTA GTTAGCCATT TTGGAATCCT
GGTCTCAAGA CATTTAGATT AGCCATGTGG AAACCTGGTC AGAGTCAAGA CATAGTCTGC GGGTTGTTAG ACTGAATTTT
ATGTTGTGCT GTCTGTTGCA ATACCTGATA TCATGTATGG TGCTTACATG ATATGAAGTC ATGGTTGCAA TACCTGTACC
TGGAAAGTTA GATATGGTTA TCTGAAAGTA TGAACTGCCT GTTTACCTGT CATCTGTTGT TTTTCTGCTT TGGCTGTCAC
TTGTGCTA

Locus: Os08g0159800

Loading...

Locus: Os08g0159800

Loading...