Os08t0160500-01

Locus

Os08g0160500

Description

MLG (mixed-linkage glucan) synthase, Biosynthesis of MLG (cell wall polysaccharide)

RAP-DB Gene Symbol Synonym(s)

CSLF6, OsCslF6, OsCSLF6

RAP-DB Gene Name Synonym(s)

CELLULOSE SYNTHASE LIKE F6

CGSNL Gene Symbol

CSLF6

CGSNL Gene Name

CELLULOSE SYNTHASE LIKE F6

Oryzabase Gene Symbol Synonym(s)

OsCslF6, OsCSLF6, OsCLD3, CLD3

Oryzabase Gene Name Synonym(s)

Transcript Evidence

NM_001067583

AK065259

Protein Evidence

Q84UP7

Literature

PMID: 22388489

Note

Manual Curation

August 28, 2014

Gene Ontology (GO)

Biological Process: cellulose biosynthetic process (GO:0030244)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Cellulose synthase (IPR005150)

Nucleotide-diphospho-sugar transferases (IPR029044)

Full-length cDNA

J013002J18 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0160500-01)

Others

Oryzabase (13906)

KEGG (Os08t0160500-01)

Transcript

3705 bp

>Os08t0160500-01 MLG (mixed-linkage glucan) synthase, Biosynthesis of MLG (cell wall polysaccharide)
CCTCCAAAAAAAACCATTTGGGTCTCTCTCCCTTTGAGAGCCCCCTACCGACACTTGTTT
GCCCTTAATTTCTATATATCCCCCACGTACTTTACGACCCATTTCTCACACCCCTCTTCT
CCTCCTCCTCTTCTTCTCCACCACCTCCATTGCTGCTCGCCTCTCTCACCTCCTCCTCCT
CCTCTTGTGTGGAGCTCGTCGGCGTCGAGGTGTAGCTAGCTAGCTAAGCTTGTTTTGCCA
TTGTTGTGTTCTTGGTGTTCGGAGAGGGAGCTTGCCTTTGCCTTGAGGGGAGAGGCAAAG
GCATTAGCAAtggcgccagcggtggccggcggcggagggaggaggaacaatgagggggtg
aacgggaacgcggcggcgccggcgtgcgtgtgcgggttcccggtgtgcgcgtgcgcgggg
gcggcggcggtggcgtcggcGGCGTCGTCGGCGGACATGGACATCGTGGCGGCGGGGCAG
ATCGGCGCCGTCAACGACGAGAGCTGGGTCGCCGTCGACCTCAGCGACAGCGACGACGCC
CCCGCCGCCGGCGACGTCCAGGGCGCCCTCGACGACCGCCCCGTCTTCCGTACCGAGAAG
ATCAAGGGCGTCCTCCTCCACCCCTACCGggtgctgatctttgtgaggctgatcgcgttc
acactgttcgtgatatggcgtatcgagcacaagaacccggacgcgatgtggctgtgggtg
acgtcgatcgccggcgagttctggttcgggttctcgtggctgctcgaccagctccccaag
ctgaacccgatcaaccgcgtccccgacctcgccgtcctccgccgccgcttcgaccacgcc
gacgggacctcctccctcccggggctggacatcttcgtcaccaccgccgacccgatcaag
gagcccatcctgtcgacggcgaactccatcctctccatcctcgccgccgactaccccgtc
gaccgcaacacctgctacctctccgacgactctgggatgctcctcacctacgaggccatg
gcggaggcggccaagttcgcgacgctgtgggtgcccttctgccggaagcacgccatcgag
ccgcgcgggcctgagagctacttcgagctcaagtcccacccctacatggggagggcgcag
gaggagttcgtcaacgaccgccgccgcgtccgcaaggagtacgacgacttcaaggccagg
atcaaCGGCCTCGAGCACGACATCAAGCAGAGGTCCGACTCCTACAACGCCGCCGCCGGC
GTCAAGGACGGCGAGCCCCGCGCCACCTGGATGGCCGACGGGTCGCAGTGGGAGGGCACC
TGGATCGAGCAGTCGGAGAACCACCGCAAGGGCGACCACGCCGGCATCGTCCTGgtgttg
ctgaaccacccgagccacgcacggcagctggggccgccggcgagcgccgacaacccgctg
gacttcagcggcgtggacgtgcggctgccgatgctggtgtacgtcgcacgtgagaagcgc
cccgggtgcaaccaccagaagaaggccggcgccatgaacgcgctgacccgcgcctccgcc
gtgctctccaactcccccttcatcctcaacctcgactgcgaccactacatcaacaactcc
caggcgctccgcgccggcatctgcttcatgctcggccgcgacagcgacaccgtcgcgttc
gtccagttcccgcagcgcttcgagggcgtcgaccccaccgacctctatgctaaccacaac
cgtatcttcttcgacggcacgctccgtgccctcgacgggctgcaggggcctatctacgtc
ggcaccgggtgtctcttccgccgcatcacgctgtacgggttcgagccgccgaggatcaac
gtcggcggaccgtgcttcccgaggctcggtgggatgttcgccaagaacaggtaccagaag
cctgggttcgagatgaccaagcctggtgccaagccggtggcgccgccgccggcggcgacg
gtggcgaaggggaagcacgggttcctgccgatgcccaagaaggcgtacggcaagtcggac
gcgttcgccgacaccatcccgcgcgcgtcgcacccgtcgccgtacgcggcggaggcggcg
gtggcggccgacgaggcggcgatcgcggaggccgtgatggtgacggcggcggcgtacgag
aagaagaccgggtgggggagcgacatcgggtgggtgtacggcacggtgacggaggacgtg
gtgaccggctaccggatgcacatcaaggggtggaggtcgcgctactgctccatctacccg
cacgcgttcatcgggacggcgccgatcaacctgacggagaggctgttccaggtgctccgg
tggtcgacgggttcgctggagatcttcttctcgaggaacaacccgctgttcgggagcacg
ttcctgcacccgctgcagcgcgtggcgtacatcaacatcaccacctacccgttcacggcg
ctgttcctcatcttctacaccaccgtgccggcgctgtcgttcgtgacggggcacttcatc
gtgcagaggccgaccaccatgttctacgtctacctcgccatcgtgctcgggacgctgctc
atcctcgccgtgctggaggtgaagtgggcgggggtcaccgtgttcgagtggttcaggaac
gggcagttctggatgacggccagctgctccgcctacctcgccgccgtgctgcaggtggtc
accaaggtggtgttccggcgggacatctcgttcaagctcacctccaagctccccgccggc
gacgagaagaaggacccctacgccgacctgtacgtggtgcggtggacgtggctcatgatc
acccccatcatcatcatcctcgtcaacatcatcggctccgccgtcgccttcgccaaggtg
ctcgacggcgagtggacgcactggctcaaggtcgccggcggcgtgttcttcaacttctgg
gtcctcttccacctctaccccttcgccaagggcatcctcgggaagcacggcaagacgccg
gtggtggtgctcgtctggtgggccttcaccttcgtcatcaccgccgtgctctacatcaac
atcccccaCATCCATGGCCCCGGCCGCCACGGCGCCGCCTCACCATCCCACGGCCACCAC
AGCGCCCATGGCACCAAGAAGTACGACTTCACCTACGCCTGGCCATGAGGACGCCGTCGC
CGGAGACGAAGAAGAAAACACAAACAAGAACAAGACGACACCAACAACACCAACAACAAC
AAACACGAGATGAGTACGTTCTACTACACGCTGCTGCAACAACACATACTACTGAACACT
GTGCATGCATTTGATCGAGCGACCCGCCAAAATTTGAAAGTTTTTTTTCTTCTTTTCTTT
TAACCTTTTTTTTTCCTCTTTTTGCCCCCTCCTCTCTCTCCTTTTCTTTCTTTTTAGTTT
TGTCCAGAAAAAAGATGGTGTTTATTTGATTTAGTTTTTTAATTACCTGTGGTAATTAAT
TATGTATTATACATTACTGCAAGGAAGAGAGGGGGGCTTACAGGTGGGGCCCGGGGGGTG
GGGTGTGGTGTATGATTGTACTGTACATGCTGGGAGATGTATGTATACGGAGACAAAAAG
ACAAGAGTCACAGAGAGTGAGAGAAAGAGAGGCTGGAAGTGGGCCCGGCCAGGTGGTGGT
GGTATTCTTTTAGTACATGGAAACAATAAATTTAATTTCATTATT

CDS

2859 bp

>Os08t0160500-01 MLG (mixed-linkage glucan) synthase, Biosynthesis of MLG (cell wall polysaccharide)
Atggcgccagcggtggccggcggcggagggaggaggaacaatgagggggtgaacgggaac
gcggcggcgccggcgtgcgtgtgcgggttcccggtgtgcgcgtgcgcgggggcggcggcg
gtggcgtcggcGGCGTCGTCGGCGGACATGGACATCGTGGCGGCGGGGCAGATCGGCGCC
GTCAACGACGAGAGCTGGGTCGCCGTCGACCTCAGCGACAGCGACGACGCCCCCGCCGCC
GGCGACGTCCAGGGCGCCCTCGACGACCGCCCCGTCTTCCGTACCGAGAAGATCAAGGGC
GTCCTCCTCCACCCCTACCGggtgctgatctttgtgaggctgatcgcgttcacactgttc
gtgatatggcgtatcgagcacaagaacccggacgcgatgtggctgtgggtgacgtcgatc
gccggcgagttctggttcgggttctcgtggctgctcgaccagctccccaagctgaacccg
atcaaccgcgtccccgacctcgccgtcctccgccgccgcttcgaccacgccgacgggacc
tcctccctcccggggctggacatcttcgtcaccaccgccgacccgatcaaggagcccatc
ctgtcgacggcgaactccatcctctccatcctcgccgccgactaccccgtcgaccgcaac
acctgctacctctccgacgactctgggatgctcctcacctacgaggccatggcggaggcg
gccaagttcgcgacgctgtgggtgcccttctgccggaagcacgccatcgagccgcgcggg
cctgagagctacttcgagctcaagtcccacccctacatggggagggcgcaggaggagttc
gtcaacgaccgccgccgcgtccgcaaggagtacgacgacttcaaggccaggatcaaCGGC
CTCGAGCACGACATCAAGCAGAGGTCCGACTCCTACAACGCCGCCGCCGGCGTCAAGGAC
GGCGAGCCCCGCGCCACCTGGATGGCCGACGGGTCGCAGTGGGAGGGCACCTGGATCGAG
CAGTCGGAGAACCACCGCAAGGGCGACCACGCCGGCATCGTCCTGgtgttgctgaaccac
ccgagccacgcacggcagctggggccgccggcgagcgccgacaacccgctggacttcagc
ggcgtggacgtgcggctgccgatgctggtgtacgtcgcacgtgagaagcgccccgggtgc
aaccaccagaagaaggccggcgccatgaacgcgctgacccgcgcctccgccgtgctctcc
aactcccccttcatcctcaacctcgactgcgaccactacatcaacaactcccaggcgctc
cgcgccggcatctgcttcatgctcggccgcgacagcgacaccgtcgcgttcgtccagttc
ccgcagcgcttcgagggcgtcgaccccaccgacctctatgctaaccacaaccgtatcttc
ttcgacggcacgctccgtgccctcgacgggctgcaggggcctatctacgtcggcaccggg
tgtctcttccgccgcatcacgctgtacgggttcgagccgccgaggatcaacgtcggcgga
ccgtgcttcccgaggctcggtgggatgttcgccaagaacaggtaccagaagcctgggttc
gagatgaccaagcctggtgccaagccggtggcgccgccgccggcggcgacggtggcgaag
gggaagcacgggttcctgccgatgcccaagaaggcgtacggcaagtcggacgcgttcgcc
gacaccatcccgcgcgcgtcgcacccgtcgccgtacgcggcggaggcggcggtggcggcc
gacgaggcggcgatcgcggaggccgtgatggtgacggcggcggcgtacgagaagaagacc
gggtgggggagcgacatcgggtgggtgtacggcacggtgacggaggacgtggtgaccggc
taccggatgcacatcaaggggtggaggtcgcgctactgctccatctacccgcacgcgttc
atcgggacggcgccgatcaacctgacggagaggctgttccaggtgctccggtggtcgacg
ggttcgctggagatcttcttctcgaggaacaacccgctgttcgggagcacgttcctgcac
ccgctgcagcgcgtggcgtacatcaacatcaccacctacccgttcacggcgctgttcctc
atcttctacaccaccgtgccggcgctgtcgttcgtgacggggcacttcatcgtgcagagg
ccgaccaccatgttctacgtctacctcgccatcgtgctcgggacgctgctcatcctcgcc
gtgctggaggtgaagtgggcgggggtcaccgtgttcgagtggttcaggaacgggcagttc
tggatgacggccagctgctccgcctacctcgccgccgtgctgcaggtggtcaccaaggtg
gtgttccggcgggacatctcgttcaagctcacctccaagctccccgccggcgacgagaag
aaggacccctacgccgacctgtacgtggtgcggtggacgtggctcatgatcacccccatc
atcatcatcctcgtcaacatcatcggctccgccgtcgccttcgccaaggtgctcgacggc
gagtggacgcactggctcaaggtcgccggcggcgtgttcttcaacttctgggtcctcttc
cacctctaccccttcgccaagggcatcctcgggaagcacggcaagacgccggtggtggtg
ctcgtctggtgggccttcaccttcgtcatcaccgccgtgctctacatcaacatcccccaC
ATCCATGGCCCCGGCCGCCACGGCGCCGCCTCACCATCCCACGGCCACCACAGCGCCCAT
GGCACCAAGAAGTACGACTTCACCTACGCCTGGCCATGA

Protein

953 aa

>Os08t0160500-01 MLG (mixed-linkage glucan) synthase, Biosynthesis of MLG (cell wall polysaccharide)
MAPAVAGGGGRRNNEGVNGNAAAPACVCGFPVCACAGAAAVASAASSADMDIVAAGQIGA
VNDESWVAVDLSDSDDAPAAGDVQGALDDRPVFRTEKIKGVLLHPYRVLIFVRLIAFTLF
VIWRIEHKNPDAMWLWVTSIAGEFWFGFSWLLDQLPKLNPINRVPDLAVLRRRFDHADGT
SSLPGLDIFVTTADPIKEPILSTANSILSILAADYPVDRNTCYLSDDSGMLLTYEAMAEA
AKFATLWVPFCRKHAIEPRGPESYFELKSHPYMGRAQEEFVNDRRRVRKEYDDFKARING
LEHDIKQRSDSYNAAAGVKDGEPRATWMADGSQWEGTWIEQSENHRKGDHAGIVLVLLNH
PSHARQLGPPASADNPLDFSGVDVRLPMLVYVAREKRPGCNHQKKAGAMNALTRASAVLS
NSPFILNLDCDHYINNSQALRAGICFMLGRDSDTVAFVQFPQRFEGVDPTDLYANHNRIF
FDGTLRALDGLQGPIYVGTGCLFRRITLYGFEPPRINVGGPCFPRLGGMFAKNRYQKPGF
EMTKPGAKPVAPPPAATVAKGKHGFLPMPKKAYGKSDAFADTIPRASHPSPYAAEAAVAA
DEAAIAEAVMVTAAAYEKKTGWGSDIGWVYGTVTEDVVTGYRMHIKGWRSRYCSIYPHAF
IGTAPINLTERLFQVLRWSTGSLEIFFSRNNPLFGSTFLHPLQRVAYINITTYPFTALFL
IFYTTVPALSFVTGHFIVQRPTTMFYVYLAIVLGTLLILAVLEVKWAGVTVFEWFRNGQF
WMTASCSAYLAAVLQVVTKVVFRRDISFKLTSKLPAGDEKKDPYADLYVVRWTWLMITPI
IIILVNIIGSAVAFAKVLDGEWTHWLKVAGGVFFNFWVLFHLYPFAKGILGKHGKTPVVV
LVWWAFTFVITAVLYINIPHIHGPGRHGAASPSHGHHSAHGTKKYDFTYAWP*

5'UTR

chr08:3550352..3550660 (- strand) : 309 bp

CDS

chr08:3550032..3550351 (- strand) : 320 bp

chr08:3547239..3547983 (- strand) : 745 bp

chr08:3544914..3546707 (- strand) : 1794 bp

3'UTR

chr08:3544377..3544913 (- strand) : 537 bp

FASTA

>Os08t0160500-01 class=Sequence position=chr08:3544377..3550660 (- strand)
CCTCCAAAAA AAACCATTTG GGTCTCTCTC CCTTTGAGAG CCCCCTACCG ACACTTGTTT GCCCTTAATT TCTATATATC
CCCCACGTAC TTTACGACCC ATTTCTCACA CCCCTCTTCT CCTCCTCCTC TTCTTCTCCA CCACCTCCAT TGCTGCTCGC
CTCTCTCACC TCCTCCTCCT CCTCTTGTGT GGAGCTCGTC GGCGTCGAGG TGTAGCTAGC TAGCTAAGCT TGTTTTGCCA
TTGTTGTGTT CTTGGTGTTC GGAGAGGGAG CTTGCCTTTG CCTTGAGGGG AGAGGCAAAG GCATTAGCAA tggcgccagc
ggtggccggc ggcggaggga ggaggaacaa tgagggggtg aacgggaacg cggcggcgcc ggcgtgcgtg tgcgggttcc
cggtgtgcgc gtgcgcgggg gcggcggcgg tggcgtcggc GGCGTCGTCG GCGGACATGG ACATCGTGGC GGCGGGGCAG
ATCGGCGCCG TCAACGACGA GAGCTGGGTC GCCGTCGACC TCAGCGACAG CGACGACGCC CCCGCCGCCG GCGACGTCCA
GGGCGCCCTC GACGACCGCC CCGTCTTCCG TACCGAGAAG ATCAAGGGCG TCCTCCTCCA CCCCTACCGG TCAGCTCTCT
CACTCCCTCC TCCATTGCTG CACTCTAGCT TCCACCTCCA ACTAATTAAT TAACCGTTTC TTCCCCCCAA AAAAAGAAAA
AAAAATCCAA AAACTAATTA ACCGTCTCCT CTACAATTAA CCAATTTAGT CGGTGTTAAT GAACTTGATT AGTACAAGTA
GTAGTAGAAC ACAGCAAGCT AAGTTTAATT ACCAGCTTTA GTAGGAAGAG TTGCAAGAGT GTGAACCAGC TAATTAATTA
CTGTGGGCGA GGCGTAGTAA TTACCACCAA CTCCAAGGAT TAATCAAATC CGGTTTAAAT CCGAGGAGAC AAGTGCACGT
TAGAGCCCCG GCCAATGGGG GAGCGCCACG TAGCGCATGG CTCGAGCCGG ACCAAAATTA GCGCGTCCCG TGGATGGGCC
TTGTCGGGCT CGGTGCGGCG CGGCCACCTT TTTTTTTTTG CCACCCTGAG CCACTGTACG GTGGGGCCCA CGCGGTGGGG
AGTTAATCGT TATTCGCTGG CCAGCCTCGT GCATGGCTGG CACGTGGGCC CACTCTCCTC AAAAGGAATA ATTGATGCAG
TAAAAAATTT ACTAGGAGTA GTACGTAGGT TTTTTTACTA GTTTGAGGGT GGTGGATTTA CTGTGGGGGT TGGATGGGTG
TAGATTTGTT GCGAAATTTG GCTGGAAATG GGAATCCGAG GTGAAATTTA TTGGATTTTT GCCGTGTAGA GGGCAGGCAG
CATGCATGGC TTGCATGTGA ATCCAAAGCT AGCAAAACAT CATTCAAAGC CTCACTGCTG CAGTTTTAGG TTGGGGCAGA
AAAAACGGTA GCAATAAAGA AGGTAATCTT TTTTGCACTG TATATAGAGA GAGAGAATAA AAAGGGAGCT GCTTTTTTTA
GGTGAAAAGA CTCGAAAAGA GTGGTGAGTT TAGGTTGTTC TAGATGATGG TGGTGTTCCT GCACTGCAGT GCTCTTTGTG
TGGATTTATT TTTAGCTAAG GGAATGATTG GGAAATTTTG CTGTGTTTTT TTGTGTAGTG GTAAAGAGAA AAGGACTAGC
ATATCATAAA GTGAGAGAGA GAAAAAAATA AAGCTTAGTG CAGGATGGAT TATGTGTGTA GCTAGGGGGG AGAGGGGGTC
AGGCTTGCAC TAAGAAAGCA ATGAATAAAA TGGGAGGGGT ACATTTTAGT ACTACGAAAT CACAGTTGCG GTGCACTTAG
ATAATAATCA CAGTATATTA AGGTCGACAA AAGTACACAT CTTGATATAC AAAACTAGTT ACAGAAAGAT GGAAAATTTT
TTACTCTAGT GAATTATTGT TAGCACTCAT GAGAAACACT TGCACTAGTT TAGGAGGAGA AGGTTCCAAA TCCTTTCTTC
TTTTTGGAAC CAATACAACT AGAACAATCT TTTTCTCCCA TTGATAGACA GATAGAGAAA GTGGCAAAAA AAGAAGAAAA
AAAAAACAGA GAGCAACGAA TCTAGGGGAG CACCACCACT AGCGTGGGCC CCACGGTGGC TGGCTGGCGC TTTCAAGGCC
TAGGGGGTGG TAGGTGGGGC CCACTGACAG CCGCATGTCG GTGCCCCCGC TGCGCAGCGA GGCCGTGAGC GCCGCGCCAG
CTCACGCGTC ATTTGACTGC CAGCTGTCTC CCCCCTCCCC GTCACATGAT TGGCTCCTCC CCCCTACCTT TAATTTTATT
TTTCTTTTTT CTTTTTTGAC ATCCATAATT AAGAATTTTC AAATGGTAAA ATAAATATAA TAGCGCTAGT TTGAACTTGA
ATATAAATAT AAAAGTGGCA ACAATTTTCT CCTCCTCTCC CATGCAGTAA TCGAGCTGTG CCTAACATGG TCCATGTTCC
CCCAATTATT GCGCCTCCTC CATCGTGCCC GTGCATGCAC TACCCCCCAA TCATTATTAC TCGTCTTCAT TAGCCACACA
TTACCTGTCC AACCAGGCAC AAGCAAAATA TAATTAACTA CTAATTAATT ACTACTTGCT AATTAACAGC AAGTGATGTG
GTTAATGTAA TAACTGGATG GTAATTGGAT Gctgcagggt gctgatcttt gtgaggctga tcgcgttcac actgttcgtg
atatggcgta tcgagcacaa gaacccggac gcgatgtggc tgtgggtgac gtcgatcgcc ggcgagttct ggttcgggtt
ctcgtggctg ctcgaccagc tccccaagct gaacccgatc aaccgcgtcc ccgacctcgc cgtcctccgc cgccgcttcg
accacgccga cgggacctcc tccctcccgg ggctggacat cttcgtcacc accgccgacc cgatcaagga gcccatcctg
tcgacggcga actccatcct ctccatcctc gccgccgact accccgtcga ccgcaacacc tgctacctct ccgacgactc
tgggatgctc ctcacctacg aggccatggc ggaggcggcc aagttcgcga cgctgtgggt gcccttctgc cggaagcacg
ccatcgagcc gcgcgggcct gagagctact tcgagctcaa gtcccacccc tacatgggga gggcgcagga ggagttcgtc
aacgaccgcc gccgcgtccg caaggagtac gacgacttca aggccaggat caaCGGCCTC GAGCACGACA TCAAGCAGAG
GTCCGACTCC TACAACGCCG CCGCCGGCGT CAAGGACGGC GAGCCCCGCG CCACCTGGAT GGCCGACGGG TCGCAGTGGG
AGGGCACCTG GATCGAGCAG TCGGAGAACC ACCGCAAGGG CGACCACGCC GGCATCGTCC TGGTCAGTAT AATTAAAAGT
TAATTAATTA TTACTCTTAT AGTACAAATC TTTTGTTTAT GTGATTATTT GGTTAGTTAG TGATGACTTG TCAGGGCGAA
TATTATTTTG GATTGGGAGA TATGTGTGGG ATTTTGATGG AATTGACGTG GTGATAGTCA AGAGCGCAAC CACCACGCAC
TAATTGCACA TTAGTAGTCG TAGCAGCATG CAGGATAATG ACTCACTTGT GTCTGAACAA GCTAGTGGTT GGGGTGGTCC
TTTCCACCCA GACAGCACCA CCACATCACC ATTAATCCAC ACCCCCCTAA TTAATCTCAC CTCCTCTCAC CATTAACTAA
CCACCATTTC TTAATTACTG CTACAAGTAC AAGTTAATTA ATTAATTACC ACAATATAAT TAACCATCAA GTTTAATTGC
AGTGATTACT AATTAATTAT TTATTACTCC TAGTAGTGGT AAATATAGGA GTAGTAATTA GTACTAGATG ACTTTTTTTT
ACTGATATGG TAAATGATGG TAAAAatgtg caggtgttgc tgaaccaccc gagccacgca cggcagctgg ggccgccggc
gagcgccgac aacccgctgg acttcagcgg cgtggacgtg cggctgccga tgctggtgta cgtcgcacgt gagaagcgcc
ccgggtgcaa ccaccagaag aaggccggcg ccatgaacgc gctgacccgc gcctccgccg tgctctccaa ctcccccttc
atcctcaacc tcgactgcga ccactacatc aacaactccc aggcgctccg cgccggcatc tgcttcatgc tcggccgcga
cagcgacacc gtcgcgttcg tccagttccc gcagcgcttc gagggcgtcg accccaccga cctctatgct aaccacaacc
gtatcttctt cgacggcacg ctccgtgccc tcgacgggct gcaggggcct atctacgtcg gcaccgggtg tctcttccgc
cgcatcacgc tgtacgggtt cgagccgccg aggatcaacg tcggcggacc gtgcttcccg aggctcggtg ggatgttcgc
caagaacagg taccagaagc ctgggttcga gatgaccaag cctggtgcca agccggtggc gccgccgccg gcggcgacgg
tggcgaaggg gaagcacggg ttcctgccga tgcccaagaa ggcgtacggc aagtcggacg cgttcgccga caccatcccg
cgcgcgtcgc acccgtcgcc gtacgcggcg gaggcggcgg tggcggccga cgaggcggcg atcgcggagg ccgtgatggt
gacggcggcg gcgtacgaga agaagaccgg gtgggggagc gacatcgggt gggtgtacgg cacggtgacg gaggacgtgg
tgaccggcta ccggatgcac atcaaggggt ggaggtcgcg ctactgctcc atctacccgc acgcgttcat cgggacggcg
ccgatcaacc tgacggagag gctgttccag gtgctccggt ggtcgacggg ttcgctggag atcttcttct cgaggaacaa
cccgctgttc gggagcacgt tcctgcaccc gctgcagcgc gtggcgtaca tcaacatcac cacctacccg ttcacggcgc
tgttcctcat cttctacacc accgtgccgg cgctgtcgtt cgtgacgggg cacttcatcg tgcagaggcc gaccaccatg
ttctacgtct acctcgccat cgtgctcggg acgctgctca tcctcgccgt gctggaggtg aagtgggcgg gggtcaccgt
gttcgagtgg ttcaggaacg ggcagttctg gatgacggcc agctgctccg cctacctcgc cgccgtgctg caggtggtca
ccaaggtggt gttccggcgg gacatctcgt tcaagctcac ctccaagctc cccgccggcg acgagaagaa ggacccctac
gccgacctgt acgtggtgcg gtggacgtgg ctcatgatca cccccatcat catcatcctc gtcaacatca tcggctccgc
cgtcgccttc gccaaggtgc tcgacggcga gtggacgcac tggctcaagg tcgccggcgg cgtgttcttc aacttctggg
tcctcttcca cctctacccc ttcgccaagg gcatcctcgg gaagcacggc aagacgccgg tggtggtgct cgtctggtgg
gccttcacct tcgtcatcac cgccgtgctc tacatcaaca tcccccaCAT CCATGGCCCC GGCCGCCACG GCGCCGCCTC
ACCATCCCAC GGCCACCACA GCGCCCATGG CACCAAGAAG TACGACTTCA CCTACGCCTG GCCATGAGGA CGCCGTCGCC
GGAGACGAAG AAGAAAACAC AAACAAGAAC AAGACGACAC CAACAACACC AACAACAACA AACACGAGAT GAGTACGTTC
TACTACACGC TGCTGCAACA ACACATACTA CTGAACACTG TGCATGCATT TGATCGAGCG ACCCGCCAAA ATTTGAAAGT
TTTTTTTCTT CTTTTCTTTT AACCTTTTTT TTTCCTCTTT TTGCCCCCTC CTCTCTCTCC TTTTCTTTCT TTTTAGTTTT
GTCCAGAAAA AAGATGGTGT TTATTTGATT TAGTTTTTTA ATTACCTGTG GTAATTAATT ATGTATTATA CATTACTGCA
AGGAAGAGAG GGGGGCTTAC AGGTGGGGCC CGGGGGGTGG GGTGTGGTGT ATGATTGTAC TGTACATGCT GGGAGATGTA
TGTATACGGA GACAAAAAGA CAAGAGTCAC AGAGAGTGAG AGAAAGAGAG GCTGGAAGTG GGCCCGGCCA GGTGGTGGTG
GTATTCTTTT AGTACATGGA AACAATAAAT TTAATTTCAT TATT

Locus: Os08g0160500

Loading...

Locus: Os08g0160500

Loading...