Os08t0160500-02

Locus

Os08g0160500

Description

Similar to Cellulose synthase-like CslF6.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CSLF6

CGSNL Gene Name

CELLULOSE SYNTHASE LIKE F6

Oryzabase Gene Symbol Synonym(s)

OsCslF6, OsCSLF6, OsCLD3, CLD3

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK109812 (DDBJ, Best hit)

Protein Evidence

D0U5L9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cellulose biosynthetic process (GO:0030244)

Cellular Component: membrane (GO:0016020)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Functional domain (InterPro)

Cellulose synthase (IPR005150)

Full-length cDNA

002-147-H02 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0160500-02)

Others

Oryzabase (13906)

KEGG (Os08t0160500-02)

Transcript

1745 bp

>Os08t0160500-02 Similar to Cellulose synthase-like CslF6.
AAAAAAAAACAGAGAGCAACGAATCTAGGGGAGCACCACCACTAGCGTGGGCCCCACGGT
GGCTGGCTGGCGCTTTCAAGGCCTAGGGGGTGGTAGGTGGGGCCCACTGACAGCCGCATG
TCGGTGCCCCCGCTGCGCAGCGAGGCCGTGAGCGCCGCGCCAGCTCACGCGTCATTTGAC
TGCCAGCTGTCTCCCCCCTCCCCGTCACATGATTGGCTCCTCCCCCCTACCTTTAATTTT
ATTTTTCTTTTTTCTTTTTTGACATCCATAATTAAGAATTTTCAAATGGTAAAATAAATA
TAATAGCGCTAGTTTGAACTTGAATATAAATATAAAAGTGGCAACAATTTTCTCCTCCTC
TCCCATGCAGTAATCGAGCTGTGCCTAACATGGTCCATGTTCCCCCAATTATTGCGCCTC
CTCCATCGTGCCCGTGCATGCACTACCCCCCAATCATTATTACTCGTCTTCATTAGCCAC
ACATTACCTGTCCAACCAGGCACAAGCAAAATATAATTAACTACTAATTAATTACTACTT
GCTAATTAACAGCAAGTGATGTGGTTAATGTAATAACTGGATGGTAATTGGATGctgcag
ggtgctgatctttgtgaggctgatcgcgttcacactgttcgtgatatggcgtatcgagca
caagaacccggacgcgatgtggctgtgggtgacgtcgatcgccggcgagttctggttcgg
gttctcgtggctgctcgaccagctccccaagctgaacccgatcaaccgcgtccccgacct
cgccgtcctccgccgccgcttcgaccacgccgacgggacctcctccctcccggggctgga
catcttcgtcaccaccgccgacccgatcaaggagcccatcctgtcgacggcgaactccat
cctctccatcctcgccgccgactaccccgtcgaccgcaacacctgctacctctccgacga
ctctgggatgctcctcacctacgaggccatggcggaggcggccaagttcgcgacgctgtg
ggtgcccttctgccggaagcacgccatcgagccgcgcgggcctgagagctacttcgagct
caagtcccacccctacatggggagggcgcaggaggagttcgtcaacgaccgccgccgcgt
ccgcaaggagtacgacgacttcaaggccaggatcaaCGGCCTCGAGCACGACATCAAGCA
GAGGTCCGACTCCTACAACGCCGCCGCCGGCGTCAAGGACGGCGAGCCCCGCGCCACCTG
GATGGCCGACGGGTCGCAGTGGGAGGGCACCTGGATCGAGCAGTCGGAGAACCACCGCAA
GGGCGACCACGCCGGCATCGTCCTGGTCAGTATAATTAAAAGTTAATTAATTATTACTCT
TATAGTACAAATCTTTTGTTTATGTGATTATTTGGTTAGTTAGTGATGACTTGTCAGGGC
GAATATTATTTTGGATTGGGAGATATGTGTGGGATTTTGATGGAATTGACGTGGTGATAG
TCAAGAGCGCAACCACCACGCACTAATTGCACATTAGTAGTCGTAGCAGCATGCAGGATA
ATGACTCACTTGTGTCTGAACAAGCTAGTGGTTGGGGTGGTCCTTTCCACCCAGACAGCA
CCACCACATCACCATTAATCCACACCCCCCTAATTAATCTCACCTCCTCTCACCATTAAC
TAACCACCATTTCTTAATTACTGCTACAAGTACAAGTTAATTAATTAATTACCACAATAT
AATTA

CDS

786 bp

>Os08t0160500-02 Similar to Cellulose synthase-like CslF6.
ATGGTAATTGGATGctgcagggtgctgatctttgtgaggctgatcgcgttcacactgttc
gtgatatggcgtatcgagcacaagaacccggacgcgatgtggctgtgggtgacgtcgatc
gccggcgagttctggttcgggttctcgtggctgctcgaccagctccccaagctgaacccg
atcaaccgcgtccccgacctcgccgtcctccgccgccgcttcgaccacgccgacgggacc
tcctccctcccggggctggacatcttcgtcaccaccgccgacccgatcaaggagcccatc
ctgtcgacggcgaactccatcctctccatcctcgccgccgactaccccgtcgaccgcaac
acctgctacctctccgacgactctgggatgctcctcacctacgaggccatggcggaggcg
gccaagttcgcgacgctgtgggtgcccttctgccggaagcacgccatcgagccgcgcggg
cctgagagctacttcgagctcaagtcccacccctacatggggagggcgcaggaggagttc
gtcaacgaccgccgccgcgtccgcaaggagtacgacgacttcaaggccaggatcaaCGGC
CTCGAGCACGACATCAAGCAGAGGTCCGACTCCTACAACGCCGCCGCCGGCGTCAAGGAC
GGCGAGCCCCGCGCCACCTGGATGGCCGACGGGTCGCAGTGGGAGGGCACCTGGATCGAG
CAGTCGGAGAACCACCGCAAGGGCGACCACGCCGGCATCGTCCTGGTCAGTATAATTAAA
AGTTAA

Protein

262 aa

>Os08t0160500-02 Similar to Cellulose synthase-like CslF6.
MVIGCCRVLIFVRLIAFTLFVIWRIEHKNPDAMWLWVTSIAGEFWFGFSWLLDQLPKLNP
INRVPDLAVLRRRFDHADGTSSLPGLDIFVTTADPIKEPILSTANSILSILAADYPVDRN
TCYLSDDSGMLLTYEAMAEAAKFATLWVPFCRKHAIEPRGPESYFELKSHPYMGRAQEEF
VNDRRRVRKEYDDFKARINGLEHDIKQRSDSYNAAAGVKDGEPRATWMADGSQWEGTWIE
QSENHRKGDHAGIVLVSIIKS*

5'UTR

chr08:3548004..3548583 (- strand) : 580 bp

CDS

chr08:3547218..3548003 (- strand) : 786 bp

3'UTR

chr08:3546839..3547217 (- strand) : 379 bp

FASTA

>Os08t0160500-02 class=Sequence position=chr08:3546839..3548583 (- strand)
AAAAAAAAAC AGAGAGCAAC GAATCTAGGG GAGCACCACC ACTAGCGTGG GCCCCACGGT GGCTGGCTGG CGCTTTCAAG
GCCTAGGGGG TGGTAGGTGG GGCCCACTGA CAGCCGCATG TCGGTGCCCC CGCTGCGCAG CGAGGCCGTG AGCGCCGCGC
CAGCTCACGC GTCATTTGAC TGCCAGCTGT CTCCCCCCTC CCCGTCACAT GATTGGCTCC TCCCCCCTAC CTTTAATTTT
ATTTTTCTTT TTTCTTTTTT GACATCCATA ATTAAGAATT TTCAAATGGT AAAATAAATA TAATAGCGCT AGTTTGAACT
TGAATATAAA TATAAAAGTG GCAACAATTT TCTCCTCCTC TCCCATGCAG TAATCGAGCT GTGCCTAACA TGGTCCATGT
TCCCCCAATT ATTGCGCCTC CTCCATCGTG CCCGTGCATG CACTACCCCC CAATCATTAT TACTCGTCTT CATTAGCCAC
ACATTACCTG TCCAACCAGG CACAAGCAAA ATATAATTAA CTACTAATTA ATTACTACTT GCTAATTAAC AGCAAGTGAT
GTGGTTAATG TAATAACTGG ATGGTAATTG GATGctgcag ggtgctgatc tttgtgaggc tgatcgcgtt cacactgttc
gtgatatggc gtatcgagca caagaacccg gacgcgatgt ggctgtgggt gacgtcgatc gccggcgagt tctggttcgg
gttctcgtgg ctgctcgacc agctccccaa gctgaacccg atcaaccgcg tccccgacct cgccgtcctc cgccgccgct
tcgaccacgc cgacgggacc tcctccctcc cggggctgga catcttcgtc accaccgccg acccgatcaa ggagcccatc
ctgtcgacgg cgaactccat cctctccatc ctcgccgccg actaccccgt cgaccgcaac acctgctacc tctccgacga
ctctgggatg ctcctcacct acgaggccat ggcggaggcg gccaagttcg cgacgctgtg ggtgcccttc tgccggaagc
acgccatcga gccgcgcggg cctgagagct acttcgagct caagtcccac ccctacatgg ggagggcgca ggaggagttc
gtcaacgacc gccgccgcgt ccgcaaggag tacgacgact tcaaggccag gatcaaCGGC CTCGAGCACG ACATCAAGCA
GAGGTCCGAC TCCTACAACG CCGCCGCCGG CGTCAAGGAC GGCGAGCCCC GCGCCACCTG GATGGCCGAC GGGTCGCAGT
GGGAGGGCAC CTGGATCGAG CAGTCGGAGA ACCACCGCAA GGGCGACCAC GCCGGCATCG TCCTGGTCAG TATAATTAAA
AGTTAATTAA TTATTACTCT TATAGTACAA ATCTTTTGTT TATGTGATTA TTTGGTTAGT TAGTGATGAC TTGTCAGGGC
GAATATTATT TTGGATTGGG AGATATGTGT GGGATTTTGA TGGAATTGAC GTGGTGATAG TCAAGAGCGC AACCACCACG
CACTAATTGC ACATTAGTAG TCGTAGCAGC ATGCAGGATA ATGACTCACT TGTGTCTGAA CAAGCTAGTG GTTGGGGTGG
TCCTTTCCAC CCAGACAGCA CCACCACATC ACCATTAATC CACACCCCCC TAATTAATCT CACCTCCTCT CACCATTAAC
TAACCACCAT TTCTTAATTA CTGCTACAAG TACAAGTTAA TTAATTAATT ACCACAATAT AATTA

Locus: Os08g0160500

Loading...

Locus: Os08g0160500

Loading...