Os08t0163400-01

Locus

Os08g0163400

Description

RNA polymerase sigma-70 domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

YGL13

CGSNL Gene Name

YELLOW-GREEN LEAF 13

Oryzabase Gene Symbol Synonym(s)

OsSIG1, SIG1, Os-SigA, OsSigA, Os Sig1, SIGA

Oryzabase Gene Name Synonym(s)

Sigma factor SIG1, plastid sigma factor SIG1, sigma A, sigma factor A, yellow-green leaf 13, yellow green leaf 13

Transcript Evidence

AK071725 (DDBJ, Best hit)

Protein Evidence

O48655 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transcription initiation, DNA-dependent (GO:0006352)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: sigma factor activity (GO:0016987)

Functional domain (InterPro)

RNA polymerase sigma-70 factor (IPR000943)

RNA polymerase sigma-70 region 3 (IPR007624)

RNA polymerase sigma-70 region 2 (IPR007627)

RNA polymerase sigma-70 region 4 (IPR007630)

Winged helix-turn-helix transcription repressor DNA-binding (IPR011991)

RNA polymerase sigma factor, region 3/4 (IPR013324)

RNA polymerase sigma factor, region 2 (IPR013325)

RNA polymerase sigma-70 (IPR014284)

Full-length cDNA

J023113B05 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0163400-01)

RiceXPro (AK071725)

Others

Oryzabase (9715)

KEGG (Os08t0163400-01)

Transcript

1921 bp

>Os08t0163400-01 RNA polymerase sigma-70 domain containing protein.
ATGGCCTCCCGCCCTCTCCGCCTCCTCTACCCTATCCTCTCCCTCCACACCCCACTCCGA
CCACCACCACCACCTCGCCCGCGGTAACGCCGCCGCCGTCGCTCGCCGCGGTAAAACCAG
CGCGCGCGAGAGAGTGGGTGTCCGTGTGGCCTACTACTTGCTTCCTCGGCGCGCGCGGCG
CGTGTGTGCCTCGCATCCTCCACCACCACTAGTGCAGCCAAGTGCGTGCGTGTGTGTGTG
TGCGGACACCGTTGCTGCCGCCGCCGCCGCCGCCGCGCGCAGGGTGGTGACAAGATGACG
GCGACGCCAGCGGTGATCGGGCTGAGCGCGGGGAACAGGCTGCTGAGCGCGTCGTTCGGG
CCGACCGACCTGATGCCCGACGCCGTCGCCCGCCTCGCGCGCCGCCCACGCCCATGACCT
CGAGTCCTCCCTCGAGGCCATCGTGCTGCTGCAGAGGTCCATGCTCGAGAAGCAGTGGGA
GCTCCCCTTCGACGACGACAACCACGCCATGGCCATCGGCTTGGCCGAGGATGACGACGA
CACCAGCAAGGCCACCGTCGTCGTGGCGCGGTCCAGTGTCTCGGCGCGGCAGAGGAGGAT
GAGCGGGCGGCGGCGGGGGAGGACCAAGAACGGCGCGGCGCACTTCGCCGTCAGCCCCGA
GCTGATCCAGAGCAGGAACAGGATCTACCTCAGGGGCACCGTCAGCAAGGAGCTCCTCAC
GCACAAGCAGGTCGTCCACCTCTCCCACAAGATCAAGGATGGCATCTGGCTGCAGCAGCA
AAGATCAAAGCTGAAAGAGAAGCTGGGAAATGAGCCCTCATACAAACAGCTGGCGCATTC
GCTGAAGATATCACCGCCCGAGCTACGATCAAGGATGCACGAGTCGTTTCTTGCAAGGGA
GATGCTAACAATGAGCAACCTCCGTTTGGTCATTTCCATTGCCCAGAAGTATGATAACCT
TGGTGTTGAGTTGGCTGACCTCATTCAGGGTGGTCTGATAGGGTTACTCCGTGGGATCGA
AAAATTTGATGCATCCAGGGGCTTTAGAATTTCCACTTATGTATACTGGTGGATACGCCA
GGGTGTTTCAAGAGCATTAGCTGAAAACTCAAAAACATTCAGGCTTCCAACTTATCTGCA
CGAGCGGCTGATTGCGATTCGTGGTGCAAAGTATGAGTTGGAAGATCAAGGAATTGCTCC
AACAATAGAAAACATAGCAGGGTCACTCAACATATCAGAAAAGAAAGTACTCAATGCTAC
AGAGGCTGTGAACAAGGTTCTTTCGTTGGATCAACAAGCATTTCCATCCTTAAACGGCTT
ACCTGGAGAGACACTGCACAGTTACATAGAGGATCAAAATGTCGCAAATGATCCATGGCA
TGGATTTGAGGAGTGGTATCTCAAGGAAGAAGTCAACAAGCTTTTAAACTCAACTCTCAA
CGAGCGTGAGAGGGACATTATCCGGTTATATCATGGCATAGGAAAACAATGCCATACATG
GGAGGATATTAGCAGACAATTCGGGTTGTCGAGGGAGAGGGTGAGGCAAGTAGGACTCAT
CGCAATGGAGAAGCTGAAGCATGCTGCGAGGAGGAAAAATTTGGAGGCATTGCTTGAGGA
TTATTGAGTTGAGGGGCTTTTTGTTTGAGTCAGATCCACAAACACAGCGGTTGTATATAC
TCAGAAAACATAGGGTACATCCTTCAAAAGGCGTACTGCCACTCACATGAAAGTAATTAT
ACGTGTACATTTTGTGACATTAGGGAGATGCATGATCAAAATCTCTATGCCTGTGTTATG
ACCAAGGCAATCAGGAAACAGAGAGATGATGTTTTTCCTTCAAGGTTTACAATTATTCTG
TAATATATATGTAAGTATGATTTAGCTTGATCAATAGAGCAACACTTAAAAGTTCTGAGC
C

CDS

1254 bp

>Os08t0163400-01 RNA polymerase sigma-70 domain containing protein.
TGCCCGACGCCGTCGCCCGCCTCGCGCGCCGCCCACGCCCATGACCTCGAGTCCTCCCTC
GAGGCCATCGTGCTGCTGCAGAGGTCCATGCTCGAGAAGCAGTGGGAGCTCCCCTTCGAC
GACGACAACCACGCCATGGCCATCGGCTTGGCCGAGGATGACGACGACACCAGCAAGGCC
ACCGTCGTCGTGGCGCGGTCCAGTGTCTCGGCGCGGCAGAGGAGGATGAGCGGGCGGCGG
CGGGGGAGGACCAAGAACGGCGCGGCGCACTTCGCCGTCAGCCCCGAGCTGATCCAGAGC
AGGAACAGGATCTACCTCAGGGGCACCGTCAGCAAGGAGCTCCTCACGCACAAGCAGGTC
GTCCACCTCTCCCACAAGATCAAGGATGGCATCTGGCTGCAGCAGCAAAGATCAAAGCTG
AAAGAGAAGCTGGGAAATGAGCCCTCATACAAACAGCTGGCGCATTCGCTGAAGATATCA
CCGCCCGAGCTACGATCAAGGATGCACGAGTCGTTTCTTGCAAGGGAGATGCTAACAATG
AGCAACCTCCGTTTGGTCATTTCCATTGCCCAGAAGTATGATAACCTTGGTGTTGAGTTG
GCTGACCTCATTCAGGGTGGTCTGATAGGGTTACTCCGTGGGATCGAAAAATTTGATGCA
TCCAGGGGCTTTAGAATTTCCACTTATGTATACTGGTGGATACGCCAGGGTGTTTCAAGA
GCATTAGCTGAAAACTCAAAAACATTCAGGCTTCCAACTTATCTGCACGAGCGGCTGATT
GCGATTCGTGGTGCAAAGTATGAGTTGGAAGATCAAGGAATTGCTCCAACAATAGAAAAC
ATAGCAGGGTCACTCAACATATCAGAAAAGAAAGTACTCAATGCTACAGAGGCTGTGAAC
AAGGTTCTTTCGTTGGATCAACAAGCATTTCCATCCTTAAACGGCTTACCTGGAGAGACA
CTGCACAGTTACATAGAGGATCAAAATGTCGCAAATGATCCATGGCATGGATTTGAGGAG
TGGTATCTCAAGGAAGAAGTCAACAAGCTTTTAAACTCAACTCTCAACGAGCGTGAGAGG
GACATTATCCGGTTATATCATGGCATAGGAAAACAATGCCATACATGGGAGGATATTAGC
AGACAATTCGGGTTGTCGAGGGAGAGGGTGAGGCAAGTAGGACTCATCGCAATGGAGAAG
CTGAAGCATGCTGCGAGGAGGAAAAATTTGGAGGCATTGCTTGAGGATTATTGA

Protein

418 aa

>Os08t0163400-01 RNA polymerase sigma-70 domain containing protein.
CPTPSPASRAAHAHDLESSLEAIVLLQRSMLEKQWELPFDDDNHAMAIGLAEDDDDTSKA
TVVVARSSVSARQRRMSGRRRGRTKNGAAHFAVSPELIQSRNRIYLRGTVSKELLTHKQV
VHLSHKIKDGIWLQQQRSKLKEKLGNEPSYKQLAHSLKISPPELRSRMHESFLAREMLTM
SNLRLVISIAQKYDNLGVELADLIQGGLIGLLRGIEKFDASRGFRISTYVYWWIRQGVSR
ALAENSKTFRLPTYLHERLIAIRGAKYELEDQGIAPTIENIAGSLNISEKKVLNATEAVN
KVLSLDQQAFPSLNGLPGETLHSYIEDQNVANDPWHGFEEWYLKEEVNKLLNSTLNERER
DIIRLYHGIGKQCHTWEDISRQFGLSRERVRQVGLIAMEKLKHAARRKNLEALLEDY*

5'UTR

chr08:3732442..3732814 (+ strand) : 373 bp

CDS

chr08:3732815..3732817 (+ strand) : 3 bp

chr08:3733048..3733460 (+ strand) : 413 bp

chr08:3733794..3733992 (+ strand) : 199 bp

chr08:3734131..3734223 (+ strand) : 93 bp

chr08:3734345..3734473 (+ strand) : 129 bp

chr08:3734789..3734842 (+ strand) : 54 bp

chr08:3734941..3735018 (+ strand) : 78 bp

chr08:3735117..3735179 (+ strand) : 63 bp

chr08:3735445..3735557 (+ strand) : 113 bp

chr08:3735736..3735844 (+ strand) : 109 bp

3'UTR

chr08:3735845..3736138 (+ strand) : 294 bp

FASTA

>Os08t0163400-01 class=Sequence position=chr08:3732442..3736138 (+ strand)
ATGGCCTCCC GCCCTCTCCG CCTCCTCTAC CCTATCCTCT CCCTCCACAC CCCACTCCGA CCACCACCAC CACCTCGCCC
GCGGTAACGC CGCCGCCGTC GCTCGCCGCG GTAAAACCAG CGCGCGCGAG AGAGTGGGTG TCCGTGTGGC CTACTACTTG
CTTCCTCGGC GCGCGCGGCG CGTGTGTGCC TCGCATCCTC CACCACCACT AGTGCAGCCA AGTGCGTGCG TGTGTGTGTG
TGCGGACACC GTTGCTGCCG CCGCCGCCGC CGCCGCGCGC AGGGTGGTGA CAAGATGACG GCGACGCCAG CGGTGATCGG
GCTGAGCGCG GGGAACAGGC TGCTGAGCGC GTCGTTCGGG CCGACCGACC TGATGCCGGA CAAGGTCAGC CTCGGCGTCG
GCGGAGGCGG GGGAGGAGGA GGAGGTGGTG GAGGTGGGGA CGCGATGTCG TTCGCGCCGC CGGCGCCCGC GACGCCGAAG
CTCACCGCGG TCGCCGCGCA CAGGCTCAAG CTCTCCCCGC ATGGCCGCGC GCAGGTCATG CGCGCGCTCA GGCACCACTC
CTCCGCGGCG GCCGCGCTCG CGCCCCCGCC CCCGCCCCCG CCCCCGCCGA CGCCGTCGCC CGCCTCGCGC GCCGCCCACG
CCCATGACCT CGAGTCCTCC CTCGAGGCCA TCGTGCTGCT GCAGAGGTCC ATGCTCGAGA AGCAGTGGGA GCTCCCCTTC
GACGACGACA ACCACGCCAT GGCCATCGGC TTGGCCGAGG ATGACGACGA CACCAGCAAG GCCACCGTCG TCGTGGCGCG
GTCCAGTGTC TCGGCGCGGC AGAGGAGGAT GAGCGGGCGG CGGCGGGGGA GGACCAAGAA CGGCGCGGCG CACTTCGCCG
TCAGCCCCGA GCTGATCCAG AGCAGGAACA GGATCTACCT CAGGGGCACC GTCAGCAAGG AGCTCCTCAC GCACAAGCAG
GTCGTCCACC TCTCCCACAA GATCAAGGAT GGCATCTGGC TGCAGCAGCA AAGATCAAAG TATGCCTCCA TTGCCACACA
CTGCAAATAT GAAATGATCA ATCCTTCATT TGAATTATCA TTTCCTCTCA AAAACATTGA AACTGTTCAA GTATATTGTT
TACATTTCAT CGTCAGCTTA AGCTTCGGAG TGAAGATCGA TTGATCGGTG TATGAAATTC ACCAAAATAC TTCAAATGAT
TTAAGTGATT TGATTCGTAT GATTTTTCAG TAATGGCCAT TCAAATTGCT ATTCTGCATT GCACTCAGTG ACCTTGCATT
TGTATGCCAT TTCTTCATAA TTTTTTTTAG CTTTCTTGAT CCTGATGGTT TGTTCCTCCA TTGTTGAACC AGGCTGAAAG
AGAAGCTGGG AAATGAGCCC TCATACAAAC AGCTGGCGCA TTCGCTGAAG ATATCACCGC CCGAGCTACG ATCAAGGATG
CACGAGTCGT TTCTTGCAAG GGAGATGCTA ACAATGAGCA ACCTCCGTTT GGTCATTTCC ATTGCCCAGA AGTATGATAA
CCTTGGTGTT GAGTTGGCTG ACCTCATTCA GGTAATGGAA TCAGTTAATT CAGCTGCCTT TGCAATTCTA ACAGAGTCTG
TTCAGTCCAA TCATCTGTTG GACACACTAG GAGGATTTTG TGTGCTTGAG ACATGTAGTA ACGTGTTGCG ATCCAATCAC
ATTTTGCAGG GTGGTCTGAT AGGGTTACTC CGTGGGATCG AAAAATTTGA TGCATCCAGG GGCTTTAGAA TTTCCACTTA
TGTATACTGG TGGATACGCC AGGTAAGAGT TCTCTGCTAT CCTGTGCTCA GGCAAATGGA TGGAAGTTCA GAATTACAGT
CAGAGATTAA CTCAATCGAT ACCTGATACA TTGTCCTTAT TTCATTGTTT CGATCGATAC CAGGGTGTTT CAAGAGCATT
AGCTGAAAAC TCAAAAACAT TCAGGCTTCC AACTTATCTG CACGAGCGGC TGATTGCGAT TCGTGGTGCA AAGTATGAGT
TGGAAGATCA AGGAATTGCT CCAACAATAG AAGTAAGGCA TACTGCACTA ACAAAATAAA AATTTGGCTA GTTCTGTTTC
CATGAACTAC AAAATATTTA CAATTGCAGT TTTCTTTGTG TATTTTAATC ATTGTTTCTT TTTATTTTTA AAATTAAAAT
TTAAAACGCA GATCTGACAG TTTGCCAACC TTTATGATGG TTTTCAGTTC TGTGAACTGC AAAGTACTTC TAGTTGCTGC
TATTGTATTT TTAACCATGC TACTTTTGTT TTTCTTTGAA AAAGATTATA TAATTTGAAT GTCGCGTCTC TGATGGTTTG
CTATAACCTT TTGGTGGTTA TTCTCAGAAC ATAGCAGGGT CACTCAACAT ATCAGAAAAG AAAGTACTCA ATGCTACAGA
GGTAATATAT CTTCATCTTG CTCGGTGGAA CTTCTTTTGT TAAATTCCTT TGATATTTCT GGCATTGTCA CAGACATTTT
TACTGGTTGA AAAATACAGG CTGTGAACAA GGTTCTTTCG TTGGATCAAC AAGCATTTCC ATCCTTAAAC GGCTTACCTG
GAGAGACACT GCACAGTGTA AGCAGCTATA TAGCTACTTT GAAACACCAT TATACATTTT CAATTTTGAA ATGTGCCACG
AGATTAAACC TTTTTCGCCC TTTCCTTGTT CTCAGTACAT AGAGGATCAA AATGTCGCAA ATGATCCATG GCATGGATTT
GAGGAGTGGT ATCTCAAGGT AACCACAGAG ATATTTGTTC CAGAAGATAA TTGCACTAAT TGCTACTAGT CCATAATCCT
GTTCTTTCTT TTATTTTTGG AAATAATCCA TCCACAAGAC AAAAGATCAT TATGACTCCA AGCATTTTGT TTTTAAAAGT
TGACTCCACA AACATATTAT AGCTCTGAGT TGGTACTGGT ATATGGATGA CCAGACCTCA TTACCTTATG TCCTTAGAGA
ATCATTGAAT GTGCTTTAAC TATAAACATT CTACTAATAC CAGGAAGAAG TCAACAAGCT TTTAAACTCA ACTCTCAACG
AGCGTGAGAG GGACATTATC CGGTTATATC ATGGCATAGG AAAACAATGC CATACATGGG AGGATATTAG CAGACAGTAA
GTATTATTTC TTCAGCTCTT ATGGACCAAG GTCCTGTACA TGTTCAACTG CCTAGTCAAG TTTGCTCGCC ATAAAAAAAA
ATCTAAAACT TTTCCATTAT TATCAAACTA TTCATAATAG TTTCTTGGTA TATTTATTAG TTTATAATAT TTGGCCTTGA
AAAATGATCC TCAGATTCGG GTTGTCGAGG GAGAGGGTGA GGCAAGTAGG ACTCATCGCA ATGGAGAAGC TGAAGCATGC
TGCGAGGAGG AAAAATTTGG AGGCATTGCT TGAGGATTAT TGAGTTGAGG GGCTTTTTGT TTGAGTCAGA TCCACAAACA
CAGCGGTTGT ATATACTCAG AAAACATAGG GTACATCCTT CAAAAGGCGT ACTGCCACTC ACATGAAAGT AATTATACGT
GTACATTTTG TGACATTAGG GAGATGCATG ATCAAAATCT CTATGCCTGT GTTATGACCA AGGCAATCAG GAAACAGAGA
GATGATGTTT TTCCTTCAAG GTTTACAATT ATTCTGTAAT ATATATGTAA GTATGATTTA GCTTGATCAA TAGAGCAACA
CTTAAAAGTT CTGAGCC

Locus: Os08g0163400

Loading...

Locus: Os08g0163400

Loading...