Os08t0174500-01

Locus

Os08g0174500

Description

Putative HAP3 subunit of the CCAAT box-binding transcription factor, Flowering time, Short-day promotion, Long-day repression

RAP-DB Gene Symbol Synonym(s)

HD5, Hd5(t)*, Hd5, qHD5, HAP3H, OsHAP3H, NF-YB, CBF-A, DTH8, qHD5(t)*, Ghd8, Ghd8/DTH8, Lhd1, NF-YB11, OsNF-YB11

RAP-DB Gene Name Synonym(s)

Heading date (QTL)-5(t), Heading date (QTL)-5(t), Heading date 5, HAP3 SUBUNIT OF CCAAT-BOX BINDING COMPLEX, days to heading8, days to heading on chromosome 8, NUCLEAR FACTOR-Y subunit B11, NUCLEAR FACTOR-Y subunit NF-YB11

CGSNL Gene Symbol

HD5

CGSNL Gene Name

Heading date (QTL)-5(t)

Oryzabase Gene Symbol Synonym(s)

Hd5(t)*, Hd5, qHD5, HAP3H, OsHAP3H, NF-YB, CBF-A, DTH8, qHD5(t)*, Ghd8, Ghd8/DTH8, Lhd1, NF-YB11, OsNF-YB11, NFYB11, LH8, DTH8/Ghd8, RH8, DTH8/Ghd8/LHD1, CAR8, DTH8/Ghd8/ OsHAP3H, EF8, OsEF8

Oryzabase Gene Name Synonym(s)

Heading date (QTL)-5(t), Heading date 5, HAP3H SUBUNIT OF CCAAT-BOX BINDING COMPLEX, days to heading8, days to heading on chromosome 8, NUCLEAR FACTOR-Y subunit B11, NUCLEAR FACTOR-Y subunit NF-YB11, rice heterosis 8, "GRAIN YIELD, PLANT HEIGHT AND HEADING DATE 8", Carbon Assimilation Rate 8, NF-YB subunit 11, NF-YB family 11, early flowering 8

Transcript Evidence

AB124651

Protein Evidence

Q0J7P4

Literature

PMID: 20566706

PMID: 23090144

Note

Manual Curation

October 1, 2014

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Molecular Function: protein heterodimerization activity (GO:0046982)

Cellular Component: intracellular (GO:0005622)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Histone-fold (IPR009072)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Transcription factor, NFYB/HAP3, conserved site (IPR003956)

Expression Databases

TENOR (Os08t0174500-00)

Others

Oryzabase (2034)

Transcript

1071 bp

>Os08t0174500-01 Putative HAP3 subunit of the CCAAT box-binding transcription factor, Flowering time, Short-day promotion, Long-day repression
TAACCTCCCCCTTCTCTCTCTCTCTAACTACACACTCTCTCTCTAGCTAGCTAGCTAGCT
ATAGCTAGTGTTGTTAGCTTCACATGAAGAGTAGGAAGAGCTATGGGCACTTGCTGAGCC
CGGTGGGCAGCCCGCCGTTGGACAACGAGTCCGGCGAGGCGGCGGCGGCGGCTGCGGCTG
GCGGCGGCGGCTGCGGGAGCAGCGCCGGGTATGTCGTCTACGGCGGCGGCGGCGGTGGGG
ACTCGCCGGCGAAGGAGCAGGACAGGTTCCTGCCGATCGCGAACGTGAGCCGCATCATGA
AGCGGTCGCTGCCGGCGAACGCCAAGATCTCCAAGGAGTCGAAGGAGACGGTGCAGGAGT
GCGTGTCGGAGTTCATCAGCTTCGTTACAGGCGAGGCCTCCGACAAGTGCCAGCGCGAGA
AGCGGAAGACCATCAACGGCGACGACCTCCTCTGGGCCATGACCACGCTGGGGTTCGAGG
CCTACGTCGGCCCGCTCAAGTCCTACCTCAACCGCTACCGCGAGGCCGAGGGCGAGAAGG
CCGACGTGCTCGGCGGCGCCGGCGGCGCCGCCGCGGCGCGCCACGGCGAGGGCGGTTGCT
GCGGCGGCGGCGGCGGCGGCGCCGATGGCGTCGTCATCGACGGGCATTACCCGCTCGCCG
GCGGCCTGTCACACTCACACCATGGTCATCAGCAGCAGGACGGCGGCGGCGACGTCGGGC
TCATGATGGGCGGCGGCGACGCCGGCGTCGGGTACAACGCCGGGGCCGGGTCGACGACGA
CGGCGTTCTACGCGCCGGCGGCGACGGCGGCGTCAGGGAACAAGGCGTACTGCGGCGGCG
ACGGGTCGAGGGTGATGGAGTTCGAGGGCATCGGCGGCGAGGAGGAGAGCGGAGGCGGCG
GCGGCGGCGGCGAGAGGGGGTTCGCCGGCCACCTCCATGGCGTGCAATGGTTTAGACTAA
AGAGGAATACTAATTAGCTAGCTAGGCACACGCGTAGTTTTATTATTACTTAATTACCGC
GTTAATTAATTGTTGATGCTGATGCTGTTTAAAATTGATTCTCCTTTTGCA

CDS

894 bp

>Os08t0174500-01 Putative HAP3 subunit of the CCAAT box-binding transcription factor, Flowering time, Short-day promotion, Long-day repression
ATGAAGAGTAGGAAGAGCTATGGGCACTTGCTGAGCCCGGTGGGCAGCCCGCCGTTGGAC
AACGAGTCCGGCGAGGCGGCGGCGGCGGCTGCGGCTGGCGGCGGCGGCTGCGGGAGCAGC
GCCGGGTATGTCGTCTACGGCGGCGGCGGCGGTGGGGACTCGCCGGCGAAGGAGCAGGAC
AGGTTCCTGCCGATCGCGAACGTGAGCCGCATCATGAAGCGGTCGCTGCCGGCGAACGCC
AAGATCTCCAAGGAGTCGAAGGAGACGGTGCAGGAGTGCGTGTCGGAGTTCATCAGCTTC
GTTACAGGCGAGGCCTCCGACAAGTGCCAGCGCGAGAAGCGGAAGACCATCAACGGCGAC
GACCTCCTCTGGGCCATGACCACGCTGGGGTTCGAGGCCTACGTCGGCCCGCTCAAGTCC
TACCTCAACCGCTACCGCGAGGCCGAGGGCGAGAAGGCCGACGTGCTCGGCGGCGCCGGC
GGCGCCGCCGCGGCGCGCCACGGCGAGGGCGGTTGCTGCGGCGGCGGCGGCGGCGGCGCC
GATGGCGTCGTCATCGACGGGCATTACCCGCTCGCCGGCGGCCTGTCACACTCACACCAT
GGTCATCAGCAGCAGGACGGCGGCGGCGACGTCGGGCTCATGATGGGCGGCGGCGACGCC
GGCGTCGGGTACAACGCCGGGGCCGGGTCGACGACGACGGCGTTCTACGCGCCGGCGGCG
ACGGCGGCGTCAGGGAACAAGGCGTACTGCGGCGGCGACGGGTCGAGGGTGATGGAGTTC
GAGGGCATCGGCGGCGAGGAGGAGAGCGGAGGCGGCGGCGGCGGCGGCGAGAGGGGGTTC
GCCGGCCACCTCCATGGCGTGCAATGGTTTAGACTAAAGAGGAATACTAATTAG

Protein

298 aa

>Os08t0174500-01 Putative HAP3 subunit of the CCAAT box-binding transcription factor, Flowering time, Short-day promotion, Long-day repression
MKSRKSYGHLLSPVGSPPLDNESGEAAAAAAAGGGGCGSSAGYVVYGGGGGGDSPAKEQD
RFLPIANVSRIMKRSLPANAKISKESKETVQECVSEFISFVTGEASDKCQREKRKTINGD
DLLWAMTTLGFEAYVGPLKSYLNRYREAEGEKADVLGGAGGAAAARHGEGGCCGGGGGGA
DGVVIDGHYPLAGGLSHSHHGHQQQDGGGDVGLMMGGGDAGVGYNAGAGSTTTAFYAPAA
TAASGNKAYCGGDGSRVMEFEGIGGEEESGGGGGGGERGFAGHLHGVQWFRLKRNTN*

5'UTR

chr08:4334740..4334822 (- strand) : 83 bp

CDS

chr08:4333846..4334739 (- strand) : 894 bp

3'UTR

chr08:4333752..4333845 (- strand) : 94 bp

FASTA

>Os08t0174500-01 class=Sequence position=chr08:4333752..4334822 (- strand)
TAACCTCCCC CTTCTCTCTC TCTCTAACTA CACACTCTCT CTCTAGCTAG CTAGCTAGCT ATAGCTAGTG TTGTTAGCTT
CACATGAAGA GTAGGAAGAG CTATGGGCAC TTGCTGAGCC CGGTGGGCAG CCCGCCGTTG GACAACGAGT CCGGCGAGGC
GGCGGCGGCG GCTGCGGCTG GCGGCGGCGG CTGCGGGAGC AGCGCCGGGT ATGTCGTCTA CGGCGGCGGC GGCGGTGGGG
ACTCGCCGGC GAAGGAGCAG GACAGGTTCC TGCCGATCGC GAACGTGAGC CGCATCATGA AGCGGTCGCT GCCGGCGAAC
GCCAAGATCT CCAAGGAGTC GAAGGAGACG GTGCAGGAGT GCGTGTCGGA GTTCATCAGC TTCGTTACAG GCGAGGCCTC
CGACAAGTGC CAGCGCGAGA AGCGGAAGAC CATCAACGGC GACGACCTCC TCTGGGCCAT GACCACGCTG GGGTTCGAGG
CCTACGTCGG CCCGCTCAAG TCCTACCTCA ACCGCTACCG CGAGGCCGAG GGCGAGAAGG CCGACGTGCT CGGCGGCGCC
GGCGGCGCCG CCGCGGCGCG CCACGGCGAG GGCGGTTGCT GCGGCGGCGG CGGCGGCGGC GCCGATGGCG TCGTCATCGA
CGGGCATTAC CCGCTCGCCG GCGGCCTGTC ACACTCACAC CATGGTCATC AGCAGCAGGA CGGCGGCGGC GACGTCGGGC
TCATGATGGG CGGCGGCGAC GCCGGCGTCG GGTACAACGC CGGGGCCGGG TCGACGACGA CGGCGTTCTA CGCGCCGGCG
GCGACGGCGG CGTCAGGGAA CAAGGCGTAC TGCGGCGGCG ACGGGTCGAG GGTGATGGAG TTCGAGGGCA TCGGCGGCGA
GGAGGAGAGC GGAGGCGGCG GCGGCGGCGG CGAGAGGGGG TTCGCCGGCC ACCTCCATGG CGTGCAATGG TTTAGACTAA
AGAGGAATAC TAATTAGCTA GCTAGGCACA CGCGTAGTTT TATTATTACT TAATTACCGC GTTAATTAAT TGTTGATGCT
GATGCTGTTT AAAATTGATT CTCCTTTTGC A