Os08t0174500-02

Locus

Os08g0174500

Description

Similar to Heading date 5.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HD5

CGSNL Gene Name

Heading date (QTL)-5(t)

Oryzabase Gene Symbol Synonym(s)

Hd5(t)*, Hd5, qHD5, HAP3H, OsHAP3H, NF-YB, CBF-A, DTH8, qHD5(t)*, Ghd8, Ghd8/DTH8, Lhd1, NF-YB11, OsNF-YB11, NFYB11, LH8, DTH8/Ghd8, RH8, DTH8/Ghd8/LHD1, CAR8, DTH8/Ghd8/ OsHAP3H, EF8, OsEF8

Oryzabase Gene Name Synonym(s)

Heading date (QTL)-5(t), Heading date 5, HAP3H SUBUNIT OF CCAAT-BOX BINDING COMPLEX, days to heading8, days to heading on chromosome 8, NUCLEAR FACTOR-Y subunit B11, NUCLEAR FACTOR-Y subunit NF-YB11, rice heterosis 8, "GRAIN YIELD, PLANT HEIGHT AND HEADING DATE 8", Carbon Assimilation Rate 8, NF-YB subunit 11, NF-YB family 11, early flowering 8

Transcript Evidence

CT837794 (DDBJ, Best hit)

Protein Evidence

Q05KQ3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: intracellular (GO:0005622)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Transcription factor, NFYB/HAP3, conserved site (IPR003956)

Transcription factor, CBFA/NFYB, DNA topoisomerase (IPR003957)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Histone-fold (IPR009072)

Others

Oryzabase (2034)

Transcript

1608 bp

>Os08t0174500-02 Similar to Heading date 5.
ACTCCCATAACCTCCCCCTTCTCTCTCTCTCTAACTACACACTCTCTCTCTAGCTAGCTA
GCTAGCTATAGCTAGTGTTGTTAGCTTCACATGAAGAGTAGGAAGAGCTATGGGCACTTG
CTGAGCCCGGTGGGCAGCCCGCCGTTGGACAACGAGTCCGGCGAGGCGGCGGCGGCGGCT
GCGGCTGGCGGCGGCGGCTGCGGGAGCAGCGCCGGGTATGTCGTCTACGGCGGCGGCGGC
GGTGGGGACTCGCCGGCGAAGGAGCAGGACAGGTTCCTGCCGATCGCGAACGTGAGCCGC
ATCATGAAGCGGTCGCTGCCGGCGAACGCCAAGATCTCCAAGGAGTCGAAGGAGACGGTG
CAGGAGTGCGTGTCGGAGTTCATCAGCTTCGTTACAGGCGAGGCCTCCGACAAGTGCCAG
CGCGAGAAGCGGAAGACCATCAACGGCGACGACCTCCTCTGGGCCATGACCACGCTGGGG
TTCGAGGCCTACGTCGGCCCGCTCAAGTCCTACCTCAACCGCTACCGCGAGGCCGAGGGC
GAGAAGGCCGACGTGCTCGGCGGCGCCGGCGGCGCCGCCGCGGCGCGCCACGGCGAGGGC
GGTTGCTGCGGCGGCGGCGGCGGCGGCGCCGATGGCGTCGTCATCGACGGGCATTACCCG
CTCGCCGGCGGCCTGTCACACTCACACCATGGTCATCAGCAGCAGGACGGCGGCGGCGAC
GTCGGGCTCATGATGGGCGGCGGCGACGCCGGCGTCGGGTACAACGCCGGGGCCGGGTCG
ACGACGACGGCGTTCTACGCGCCGGCGGCGACGGCGGCGTCAGGGAACAAGGCGTACTGC
GGCGGCGACGGGTCGAGGGTGATGGAGTTCGAGGGCATCATTGTCGCGCTCTACACGGCC
TGGAGGATGCTGTTGTACTGCCCTTTTTCACTACCGTCGCTCCGGCTCCACGCATGAACC
AGCGGCGTGGCAGCTGCCAACGATGCTGTGTCTGCTGCTGCACCAGCAGCGTTGGGACGA
AACGAGTCACCATCGTTAGTGAGACAACTATCCCATGTGTGCCGGCGGTGGGGAACTAGA
CATTCGGACCGTTGCCAGTATCGCATTCGTGCGGCCTCTTGGCACTGGCACGTAACTTGG
CGTTGGTTATCAGGAATTCCTCAATCTAGACAACGTGGGCATGCGGGTCATAACGAACCC
TAGCAACGCGGGTGACGTCGCCCATGCTGTTGTCGTTATCGAGCGAGCCGCCAGCAAGGA
GGCAACGGAGGTGGTTGAACAACGAGACGGTGGGCGCCCACCCTCATGCTCACCCTAGTG
GCGACGGCGACAGAGAAGGCCGGCGGAGGGAGAGACACTGACCAGTGAATCTCACACCGG
TTTTTACCATACGTTAccacgttggcatgctacgtgggcaaaaataataaatagttaaga
aatcacgtcttaaaagcggtaaaaaaagtataaattaagaaggatatttagacaattacc
aaacttaatagttacaaatagttaaatttccATGTTTTATGGGCTCTATGATTTGGATTA
CTCGTGCTTCTGGTTCCTATGGGTAAATCTTGTGTGTCTTTCGATCAC

CDS

867 bp

>Os08t0174500-02 Similar to Heading date 5.
ATGAAGAGTAGGAAGAGCTATGGGCACTTGCTGAGCCCGGTGGGCAGCCCGCCGTTGGAC
AACGAGTCCGGCGAGGCGGCGGCGGCGGCTGCGGCTGGCGGCGGCGGCTGCGGGAGCAGC
GCCGGGTATGTCGTCTACGGCGGCGGCGGCGGTGGGGACTCGCCGGCGAAGGAGCAGGAC
AGGTTCCTGCCGATCGCGAACGTGAGCCGCATCATGAAGCGGTCGCTGCCGGCGAACGCC
AAGATCTCCAAGGAGTCGAAGGAGACGGTGCAGGAGTGCGTGTCGGAGTTCATCAGCTTC
GTTACAGGCGAGGCCTCCGACAAGTGCCAGCGCGAGAAGCGGAAGACCATCAACGGCGAC
GACCTCCTCTGGGCCATGACCACGCTGGGGTTCGAGGCCTACGTCGGCCCGCTCAAGTCC
TACCTCAACCGCTACCGCGAGGCCGAGGGCGAGAAGGCCGACGTGCTCGGCGGCGCCGGC
GGCGCCGCCGCGGCGCGCCACGGCGAGGGCGGTTGCTGCGGCGGCGGCGGCGGCGGCGCC
GATGGCGTCGTCATCGACGGGCATTACCCGCTCGCCGGCGGCCTGTCACACTCACACCAT
GGTCATCAGCAGCAGGACGGCGGCGGCGACGTCGGGCTCATGATGGGCGGCGGCGACGCC
GGCGTCGGGTACAACGCCGGGGCCGGGTCGACGACGACGGCGTTCTACGCGCCGGCGGCG
ACGGCGGCGTCAGGGAACAAGGCGTACTGCGGCGGCGACGGGTCGAGGGTGATGGAGTTC
GAGGGCATCATTGTCGCGCTCTACACGGCCTGGAGGATGCTGTTGTACTGCCCTTTTTCA
CTACCGTCGCTCCGGCTCCACGCATGA

Protein

289 aa

>Os08t0174500-02 Similar to Heading date 5.
MKSRKSYGHLLSPVGSPPLDNESGEAAAAAAAGGGGCGSSAGYVVYGGGGGGDSPAKEQD
RFLPIANVSRIMKRSLPANAKISKESKETVQECVSEFISFVTGEASDKCQREKRKTINGD
DLLWAMTTLGFEAYVGPLKSYLNRYREAEGEKADVLGGAGGAAAARHGEGGCCGGGGGGA
DGVVIDGHYPLAGGLSHSHHGHQQQDGGGDVGLMMGGGDAGVGYNAGAGSTTTAFYAPAA
TAASGNKAYCGGDGSRVMEFEGIIVALYTAWRMLLYCPFSLPSLRLHA*

5'UTR

chr08:4334740..4334829 (- strand) : 90 bp

CDS

chr08:4333951..4334739 (- strand) : 789 bp

chr08:4332757..4332834 (- strand) : 78 bp

3'UTR

chr08:4332106..4332756 (- strand) : 651 bp

FASTA

>Os08t0174500-02 class=Sequence position=chr08:4332106..4334829 (- strand)
ACTCCCATAA CCTCCCCCTT CTCTCTCTCT CTAACTACAC ACTCTCTCTC TAGCTAGCTA GCTAGCTATA GCTAGTGTTG
TTAGCTTCAC ATGAAGAGTA GGAAGAGCTA TGGGCACTTG CTGAGCCCGG TGGGCAGCCC GCCGTTGGAC AACGAGTCCG
GCGAGGCGGC GGCGGCGGCT GCGGCTGGCG GCGGCGGCTG CGGGAGCAGC GCCGGGTATG TCGTCTACGG CGGCGGCGGC
GGTGGGGACT CGCCGGCGAA GGAGCAGGAC AGGTTCCTGC CGATCGCGAA CGTGAGCCGC ATCATGAAGC GGTCGCTGCC
GGCGAACGCC AAGATCTCCA AGGAGTCGAA GGAGACGGTG CAGGAGTGCG TGTCGGAGTT CATCAGCTTC GTTACAGGCG
AGGCCTCCGA CAAGTGCCAG CGCGAGAAGC GGAAGACCAT CAACGGCGAC GACCTCCTCT GGGCCATGAC CACGCTGGGG
TTCGAGGCCT ACGTCGGCCC GCTCAAGTCC TACCTCAACC GCTACCGCGA GGCCGAGGGC GAGAAGGCCG ACGTGCTCGG
CGGCGCCGGC GGCGCCGCCG CGGCGCGCCA CGGCGAGGGC GGTTGCTGCG GCGGCGGCGG CGGCGGCGCC GATGGCGTCG
TCATCGACGG GCATTACCCG CTCGCCGGCG GCCTGTCACA CTCACACCAT GGTCATCAGC AGCAGGACGG CGGCGGCGAC
GTCGGGCTCA TGATGGGCGG CGGCGACGCC GGCGTCGGGT ACAACGCCGG GGCCGGGTCG ACGACGACGG CGTTCTACGC
GCCGGCGGCG ACGGCGGCGT CAGGGAACAA GGCGTACTGC GGCGGCGACG GGTCGAGGGT GATGGAGTTC GAGGGCATCG
GCGGCGAGGA GGAGAGCGGA GGCGGCGGCG GCGGCGGCGA GAGGGGGTTC GCCGGCCACC TCCATGGCGT GCAATGGTTT
AGACTAAAGA GGAATACTAA TTAGCTAGCT AGGCACACGC GTAGTTTTAT TATTACTTAA TTACCGCGTT AATTAATTGT
TGATGCTGAT GCTGTTTAAA ATTGATTCTC CTTTTGCATG AAATGTTTGA TGGTATGGTT TAAAATTGAA GAAAAATAGT
CCTTGAAATT TCTGTAGGAG TTCGGTTGTG ATCCAAATCC AATCAGATAT GTGTAGTTTG GCCCATGGCG GCTCACGCTC
ATCTGGGCTT GGCACATTGG GGAAAACATA TATTTAAACA TATACTTTTT GAAGTGTGAA TCAAATAATC TATTTCAATA
GTATGATAAA TAAGCTAAAA AGAACATGTG GCTAACAACA TTCGCACGGT AATTTTTCGT TTCAATTAGA CGGAAGACTT
CTAGTCACCT GTTGTTATTT TAgggaaaat ttaatttttt ttccactata aattttctca attatctaaa tgttctttct
agatttgcta tttttttatt actcttaaga ggtggtttct gaactatttt ccttttttct caagtggcat gccaacatgg
caatataggg tgaaaatggt gtgggaccGA TAATTGCAAT TTTGATTCAA ATTTTCGGAC CCCCAGCAAG TCATTACATC
GACATAAATT TTCGGGTTTT CTTAATTTCT TTTGTTCAAT TTGATAATAA TTTATTTAAA TTCAGTCAAA ATTTGTTAAA
ATTTTAAATA ATTTCGGTTC AAAAGTGCTG AAAACCAAGA AGTTTGTAAA TTTCGGTGCT ACCGAAATTT TCACCAAAAA
CGAAACTGCA AACCATGTGT AGGACGCACT GGTCAGTGTC TCTCCCTCCG CTGGCCTTCT CTCTCACTGC CGCTGCCGTG
GCTAGGCCCT CTTTGCTGCC ATCGCCGTGA GGGTGAGCAT GAGGGTGGGT GTCTACCACC CGACAGCTGC CCTGGTGTTC
GACCGCCTCC TCGTTGGCGG CTTGCACGAT GATAATGGCA GCATGAGTTA CATCGTCGGT GTCCACCTTT CCCTCATTGT
CGCGCTCTAC ACGGCCTGGA GGATGCTGTT GTACTGCCCT TTTTCACTAC CGTCGCTCCG GCTCCACGCA TGAACCAGCG
GCGTGGCAGC TGCCAACGAT GCTGTGTCTG CTGCTGCACC AGCAGCGTTG GGACGAAACG AGTCACCATC GTTAGTGAGA
CAACTATCCC ATGTGTGCCG GCGGTGGGGA ACTAGACATT CGGACCGTTG CCAGTATCGC ATTCGTGCGG CCTCTTGGCA
CTGGCACGTA ACTTGGCGTT GGTTATCAGG AATTCCTCAA TCTAGACAAC GTGGGCATGC GGGTCATAAC GAACCCTAGC
AACGCGGGTG ACGTCGCCCA TGCTGTTGTC GTTATCGAGC GAGCCGCCAG CAAGGAGGCA ACGGAGGTGG TTGAACAACG
AGACGGTGGG CGCCCACCCT CATGCTCACC CTAGTGGCGA CGGCGACAGA GAAGGCCGGC GGAGGGAGAG ACACTGACCA
GTGAATCTCA CACCGGTTTT TACCATACGT TAccacgttg gcatgctacg tgggcaaaaa taataaatag ttaagaaatc
acgtcttaaa agcggtaaaa aaagtataaa ttaagaagga tatttagaca attaccaaac ttaatagtta caaatagtta
aatttccATG TTTTATGGGC TCTATGATTT GGATTACTCG TGCTTCTGGT TCCTATGGGT AAATCTTGTG TGTCTTTCGA
TCAC