Os08t0175300-01

Locus

Os08g0175300

Description

PolI-like DNA polymerase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

PolI-like, OsPoLP1, PoLP1, OsRpoLp, RpoLp

Oryzabase Gene Name Synonym(s)

PolI-like DNA polymerase, plastidal DNA polymerase 1

Transcript Evidence

AK103236 (DDBJ, Best hit)

Protein Evidence

Q8S9E2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: nucleobase-containing compound metabolic process (GO:0006139)

Biological Process: DNA replication (GO:0006260)

Cellular Component: intracellular (GO:0005622)

Molecular Function: nucleic acid binding (GO:0003676)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: DNA-directed DNA polymerase activity (GO:0003887)

Molecular Function: 3'-5' exonuclease activity (GO:0008408)

Functional domain (InterPro)

DNA-directed DNA polymerase, family A, palm domain (IPR001098)

DNA polymerase A (IPR002298)

3'-5' exonuclease (IPR002562)

Ribonuclease H-like (IPR012337)

Full-length cDNA

J033123F03 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0175300-01)

RiceXPro (AK103236)

Others

Oryzabase (19597)

KEGG (Os08t0175300-01)

Transcript

3776 bp

>Os08t0175300-01 PolI-like DNA polymerase.
GCCGCTTAAACCCTGGTCCCCCTTGTCTCCCAAACCCTCTCTCCTTCCCCTCGCTTCCGC
CTCCGGCCGCCGCCGCCGCCGCCGCGAGGCCACCGCCTGCTGCTGCAGCGGCCTACCCTT
GCGTCGGTGCAAGACGGCGCCCTGCGGCTTCGGTTGCGGGGTGGGTGGTGGCGTTGCGGG
AGGAGGAGGAGGGAGGCGGGCGGGGTCCAAGCTGAGGCGGCTCGTGAGGTCCATGGCGGT
GGCGCCGCCGCTGCCGCCGGCACCGGCGCGGCAGCTACGGCGGTGGAAGGGGTCTTCGCC
GCGGCCGCCGCCGTGGCTGTCCTCTCCCTTCCGCCGCACCCGCTACTTGTCGCGCCCGGC
CTTCGCCGCGGGAGGAAGGCAAGATTATTCTCCTAGTTCAGGCATGGGGGTTAGCAAAAC
CGGTGCTTTCAGGCTTGGATTGTATGGCAACTTAAATGTACAAAGTAGTGTGCAAGAATG
GGTTGATGAAACCAAGAGGTTATTTTTCCTCAGGACCACAAACAGTGTCAGAAACAACAT
CACTAATGGCACTACTCCTCTGCGGGTTGGAAATCTGCGTCATGATCCCTCAGAAGATAT
CAGGAGTTCAAACTATCCTTCCTTGTATAATCAAAGAGAAAGAGGACCATCTAATTCAAT
TGTAAATAGACATGTCGATACAGATTTGGCTAAGCATCGTGTGATGTATCAGTCAGCACA
TGCTGTGCCTGCCCCATTCAGTGTTGTTAATAATGATATCAAACCACTGAACATGCTTGA
TGGCTCCAAGGAGGAAATTCCTTGGCACGATTCCGTTACGATGGAATCTTCTCTGCCTAA
AGTTTCCAAGTCAGAGAAAACTTTGGTGGTTGATAAAGCTATCCCAGACAAAAAGGAGCA
CAAACGCATTACAAGGAAGGTGACGCCAAATTTCCCGGACAAAGCTTCCTTGTCCACTGA
GTCAAAAAATGCACGGAAGTTGCTTGCTACCATCTATGACAAAGTTTTGGTTGTCGACAA
TGTTGAGTCAGCTAGGAGTGTTGTTAAATTGCTTACTACAAAGTACAAAGGCTTTATTCA
TGCATGTGACACGGAGGTGGCAAATATTGATGTCAAAGAAGAGACACCAGTTGGTCACGG
AGAAGTAATATGCTTTAGCATCTGTTCAGGAAATTCTGATGGGGAGGCTGATTTTGGAAA
TGGTAAAACATGCATATGGGTGGATGTGCTAGATGGTGGAAGGGATGTTCTAATGGAGTT
TGCTCCTTTCTTTGAGGACCCATTTATCAAAAAGGTTTGGCATAACTATAGTTTTGATAT
CCATGTCATTGAGAACTGTGGAATCAAGGTTGCTGGATTTCATGCTGATACGATGCATCT
TGCACGCCTGTGGGATTCTTCCAGGAGAACTGATGGTGGATATTCACTTGAAGGACTAAC
AAATGATTACAGAGTCATGGATGCTGTTCTAAAGGACATACCTAAAACTGGGAAGGTGTC
AATGAAAACTATCTTTGGCCGGAAAAAGGTTAGAAAAGATGGATCTGAAGGGAAAACCAT
ATCTATCGAGCCAGTCGAAAAGTTACAAAGGGAGGATAGAGAGTTGTGGATTTGCTATTC
CTCACTAGATTCAATGAGTACATTGAAGCTTTATGAAAGCTTGAAAAACAAGCTTGAAGC
AAAGGAATGGATTTTCGATGATTGTCCTAGAGGAACAATGTATGATTTCTACGAAGAGTA
TTGGCGTCCCTTTGGTGCTCTTCTTGTAAAGATGGAAACAGAGGGAGTGCTTGTTGACCG
TGCATACCTTTCGGAGATTGAGAAAGCTGCTGTTACTGAACGAGAATTAGCAGCGGATAA
GTTTCGGAAATGGGCATCTAAGCATTGTCCTGATGCCAAGTACATGAATGTGAATAGTGA
TAATCAAATTCGCCAACTTTTCTTTGGTGGCATCGAAAATAGAAATAAGCGTGGTGAAAC
TTGGCCACAAAGTAAAACTTTTAAAGTGCCAAATGATGAAGGCATAGCTACAGAGGGCAA
GAAGACTCCAAAGTCTCGCACAATCAAACTTTTCACTATTGTGGAAGATCTTAAAATTGA
TATGTTCACCCCGACTGGTTGGCCTTCAGTCAGTGGGGACGTTTTAAGGAGTTTGGCTGG
TAAAATACCCACAGATCATATATATAAAATTGATGATGGCCAAGAGTTTGATGAAGATGG
GAGCAGTTTGGAACTTCCTGAGCAGGATATAGAAGACACTTCCCCATATGGAACTGCATA
TGAAGCGTTTGGTGGAGGAAAGAAGGGAAGGGAAGCATGTCATGCCATTGCTGCTCTATG
TGAAGTCTTTTCTATTGACAAATTGATATCCGGCTTCATTGTTCCATTGCAGGGAGATCG
TATATCATGCAAGGAAGGGCGCATTCACTGTTCATTAAATATCAATACTGAAACAGGACG
CTTGTCAGCAAGAACACCAAACTTACAGAATCAACCTGCTCTTGAAAAGGATAGGTACAA
GATTCGCCATGCTTTTGTCGCAGCTCCAGGGAACACTCTTATTGTTGCTGATTATGGCCA
ACTGGAACTGAGGATCTTGGCGCATCTTACTAATTGTAAAAGCATGCTGGAAGCTTTCAA
GGCTGGTGGTGACTTCCATTCTAGGACAGCCATGAATATGTACCAGCATGTTCGTGATGC
TGTTGAAGAAAAGAAAGTTCTGCTTGAATGGCATCCTCAACCAGGTCAAGACAAACCCCC
AGTGCCATTATTGAAGGATGCTTTTGGCGCTGAGAGGAGGAAGGCCAAAATGCTTAATTT
CTCCATTGCATATGGGAAGACTGCTGTTGGTCTATCTTGGGATTGGAAGGTTTCTGTTAG
GGAAGCAAGGGATACACTCAAACTTTGGTATAGGGATAGAAAGGAAGTTTCAGCTTGGCA
AAAGAAGCAGAAAGCCTTTGCGCTTGAAAAGTGCGAAGTCTACACTTTGCTCGGGCGATC
ACGCCAATTTCCTAATATGACTCATGCGGGTCCTGGTCAAAAGGGTCACGTCGAGCGTGC
TGCTATAAATGCACCAGTGCAGGGCAGTGCAGCAGATGTTGCTATGTGTGCAATGCTTGA
GATAGAAAGAAACGCTCGCCTTAAGGAGCTTGGTTGGAGACTCCTATTGCAGGTGCATGA
TGAAGTAATCTTGGAGGGGCCTACAGAATCTGCCGAGGAAGCCAAGACCATCGTTGTGGA
GTGCATGTCCAAGCCTTTCTATGGAACCAACATCCTCAAGGTCGACCTAGCTGTCGACGC
CAAGTACGCGAAGAGCTGGTATGCTGCCAAGTAGTAGAATCCGCACTCGGTTCTTCTGCC
CTATACATAGCCAGATGAGCACATTTGTCTGCCCCAAAGTTAGGCGACACCAAAGTTATG
TGTCGCCGATGCGATGAAGACTCTGCCCATCCGTCCTGACGAAATACAGCGGACTGAACC
AGCACAGATAGAGATGCAAGCCGCTCAAGAAGTTGAAGTGCCACCCCCATCACCCACAGG
AACACAAGACCACACGTCCATTTTTCGGTGGCAGAGGCAGAGCATCCAAGAACCGAATAG
GCTGAAGACTCTTTCACTGGCAGTAGCTGAATGTACACTAGTAGCCTGTCCGATAGTTAC
TCCATTAGATTTGGATTTGACTGTAGAGACCACAGTAGATACTGACCTGTATGAGACTTT
CAGATACTTGATCATGAAGGAAGTGCAGAAGCATGCTGTCTTCATATGACCTGTTC

CDS

3102 bp

>Os08t0175300-01 PolI-like DNA polymerase.
ATGGCGGTGGCGCCGCCGCTGCCGCCGGCACCGGCGCGGCAGCTACGGCGGTGGAAGGGG
TCTTCGCCGCGGCCGCCGCCGTGGCTGTCCTCTCCCTTCCGCCGCACCCGCTACTTGTCG
CGCCCGGCCTTCGCCGCGGGAGGAAGGCAAGATTATTCTCCTAGTTCAGGCATGGGGGTT
AGCAAAACCGGTGCTTTCAGGCTTGGATTGTATGGCAACTTAAATGTACAAAGTAGTGTG
CAAGAATGGGTTGATGAAACCAAGAGGTTATTTTTCCTCAGGACCACAAACAGTGTCAGA
AACAACATCACTAATGGCACTACTCCTCTGCGGGTTGGAAATCTGCGTCATGATCCCTCA
GAAGATATCAGGAGTTCAAACTATCCTTCCTTGTATAATCAAAGAGAAAGAGGACCATCT
AATTCAATTGTAAATAGACATGTCGATACAGATTTGGCTAAGCATCGTGTGATGTATCAG
TCAGCACATGCTGTGCCTGCCCCATTCAGTGTTGTTAATAATGATATCAAACCACTGAAC
ATGCTTGATGGCTCCAAGGAGGAAATTCCTTGGCACGATTCCGTTACGATGGAATCTTCT
CTGCCTAAAGTTTCCAAGTCAGAGAAAACTTTGGTGGTTGATAAAGCTATCCCAGACAAA
AAGGAGCACAAACGCATTACAAGGAAGGTGACGCCAAATTTCCCGGACAAAGCTTCCTTG
TCCACTGAGTCAAAAAATGCACGGAAGTTGCTTGCTACCATCTATGACAAAGTTTTGGTT
GTCGACAATGTTGAGTCAGCTAGGAGTGTTGTTAAATTGCTTACTACAAAGTACAAAGGC
TTTATTCATGCATGTGACACGGAGGTGGCAAATATTGATGTCAAAGAAGAGACACCAGTT
GGTCACGGAGAAGTAATATGCTTTAGCATCTGTTCAGGAAATTCTGATGGGGAGGCTGAT
TTTGGAAATGGTAAAACATGCATATGGGTGGATGTGCTAGATGGTGGAAGGGATGTTCTA
ATGGAGTTTGCTCCTTTCTTTGAGGACCCATTTATCAAAAAGGTTTGGCATAACTATAGT
TTTGATATCCATGTCATTGAGAACTGTGGAATCAAGGTTGCTGGATTTCATGCTGATACG
ATGCATCTTGCACGCCTGTGGGATTCTTCCAGGAGAACTGATGGTGGATATTCACTTGAA
GGACTAACAAATGATTACAGAGTCATGGATGCTGTTCTAAAGGACATACCTAAAACTGGG
AAGGTGTCAATGAAAACTATCTTTGGCCGGAAAAAGGTTAGAAAAGATGGATCTGAAGGG
AAAACCATATCTATCGAGCCAGTCGAAAAGTTACAAAGGGAGGATAGAGAGTTGTGGATT
TGCTATTCCTCACTAGATTCAATGAGTACATTGAAGCTTTATGAAAGCTTGAAAAACAAG
CTTGAAGCAAAGGAATGGATTTTCGATGATTGTCCTAGAGGAACAATGTATGATTTCTAC
GAAGAGTATTGGCGTCCCTTTGGTGCTCTTCTTGTAAAGATGGAAACAGAGGGAGTGCTT
GTTGACCGTGCATACCTTTCGGAGATTGAGAAAGCTGCTGTTACTGAACGAGAATTAGCA
GCGGATAAGTTTCGGAAATGGGCATCTAAGCATTGTCCTGATGCCAAGTACATGAATGTG
AATAGTGATAATCAAATTCGCCAACTTTTCTTTGGTGGCATCGAAAATAGAAATAAGCGT
GGTGAAACTTGGCCACAAAGTAAAACTTTTAAAGTGCCAAATGATGAAGGCATAGCTACA
GAGGGCAAGAAGACTCCAAAGTCTCGCACAATCAAACTTTTCACTATTGTGGAAGATCTT
AAAATTGATATGTTCACCCCGACTGGTTGGCCTTCAGTCAGTGGGGACGTTTTAAGGAGT
TTGGCTGGTAAAATACCCACAGATCATATATATAAAATTGATGATGGCCAAGAGTTTGAT
GAAGATGGGAGCAGTTTGGAACTTCCTGAGCAGGATATAGAAGACACTTCCCCATATGGA
ACTGCATATGAAGCGTTTGGTGGAGGAAAGAAGGGAAGGGAAGCATGTCATGCCATTGCT
GCTCTATGTGAAGTCTTTTCTATTGACAAATTGATATCCGGCTTCATTGTTCCATTGCAG
GGAGATCGTATATCATGCAAGGAAGGGCGCATTCACTGTTCATTAAATATCAATACTGAA
ACAGGACGCTTGTCAGCAAGAACACCAAACTTACAGAATCAACCTGCTCTTGAAAAGGAT
AGGTACAAGATTCGCCATGCTTTTGTCGCAGCTCCAGGGAACACTCTTATTGTTGCTGAT
TATGGCCAACTGGAACTGAGGATCTTGGCGCATCTTACTAATTGTAAAAGCATGCTGGAA
GCTTTCAAGGCTGGTGGTGACTTCCATTCTAGGACAGCCATGAATATGTACCAGCATGTT
CGTGATGCTGTTGAAGAAAAGAAAGTTCTGCTTGAATGGCATCCTCAACCAGGTCAAGAC
AAACCCCCAGTGCCATTATTGAAGGATGCTTTTGGCGCTGAGAGGAGGAAGGCCAAAATG
CTTAATTTCTCCATTGCATATGGGAAGACTGCTGTTGGTCTATCTTGGGATTGGAAGGTT
TCTGTTAGGGAAGCAAGGGATACACTCAAACTTTGGTATAGGGATAGAAAGGAAGTTTCA
GCTTGGCAAAAGAAGCAGAAAGCCTTTGCGCTTGAAAAGTGCGAAGTCTACACTTTGCTC
GGGCGATCACGCCAATTTCCTAATATGACTCATGCGGGTCCTGGTCAAAAGGGTCACGTC
GAGCGTGCTGCTATAAATGCACCAGTGCAGGGCAGTGCAGCAGATGTTGCTATGTGTGCA
ATGCTTGAGATAGAAAGAAACGCTCGCCTTAAGGAGCTTGGTTGGAGACTCCTATTGCAG
GTGCATGATGAAGTAATCTTGGAGGGGCCTACAGAATCTGCCGAGGAAGCCAAGACCATC
GTTGTGGAGTGCATGTCCAAGCCTTTCTATGGAACCAACATCCTCAAGGTCGACCTAGCT
GTCGACGCCAAGTACGCGAAGAGCTGGTATGCTGCCAAGTAG

Protein

1034 aa

>Os08t0175300-01 PolI-like DNA polymerase.
MAVAPPLPPAPARQLRRWKGSSPRPPPWLSSPFRRTRYLSRPAFAAGGRQDYSPSSGMGV
SKTGAFRLGLYGNLNVQSSVQEWVDETKRLFFLRTTNSVRNNITNGTTPLRVGNLRHDPS
EDIRSSNYPSLYNQRERGPSNSIVNRHVDTDLAKHRVMYQSAHAVPAPFSVVNNDIKPLN
MLDGSKEEIPWHDSVTMESSLPKVSKSEKTLVVDKAIPDKKEHKRITRKVTPNFPDKASL
STESKNARKLLATIYDKVLVVDNVESARSVVKLLTTKYKGFIHACDTEVANIDVKEETPV
GHGEVICFSICSGNSDGEADFGNGKTCIWVDVLDGGRDVLMEFAPFFEDPFIKKVWHNYS
FDIHVIENCGIKVAGFHADTMHLARLWDSSRRTDGGYSLEGLTNDYRVMDAVLKDIPKTG
KVSMKTIFGRKKVRKDGSEGKTISIEPVEKLQREDRELWICYSSLDSMSTLKLYESLKNK
LEAKEWIFDDCPRGTMYDFYEEYWRPFGALLVKMETEGVLVDRAYLSEIEKAAVTERELA
ADKFRKWASKHCPDAKYMNVNSDNQIRQLFFGGIENRNKRGETWPQSKTFKVPNDEGIAT
EGKKTPKSRTIKLFTIVEDLKIDMFTPTGWPSVSGDVLRSLAGKIPTDHIYKIDDGQEFD
EDGSSLELPEQDIEDTSPYGTAYEAFGGGKKGREACHAIAALCEVFSIDKLISGFIVPLQ
GDRISCKEGRIHCSLNINTETGRLSARTPNLQNQPALEKDRYKIRHAFVAAPGNTLIVAD
YGQLELRILAHLTNCKSMLEAFKAGGDFHSRTAMNMYQHVRDAVEEKKVLLEWHPQPGQD
KPPVPLLKDAFGAERRKAKMLNFSIAYGKTAVGLSWDWKVSVREARDTLKLWYRDRKEVS
AWQKKQKAFALEKCEVYTLLGRSRQFPNMTHAGPGQKGHVERAAINAPVQGSAADVAMCA
MLEIERNARLKELGWRLLLQVHDEVILEGPTESAEEAKTIVVECMSKPFYGTNILKVDLA
VDAKYAKSWYAAK*

5'UTR

chr08:4400526..4400757 (- strand) : 232 bp

CDS

chr08:4400380..4400525 (- strand) : 146 bp

chr08:4399034..4399751 (- strand) : 718 bp

chr08:4398418..4398615 (- strand) : 198 bp

chr08:4395768..4396435 (- strand) : 668 bp

chr08:4394900..4395329 (- strand) : 430 bp

chr08:4394268..4394363 (- strand) : 96 bp

chr08:4393362..4393454 (- strand) : 93 bp

chr08:4393087..4393281 (- strand) : 195 bp

chr08:4392434..4392526 (- strand) : 93 bp

chr08:4392047..4392259 (- strand) : 213 bp

chr08:4391880..4391969 (- strand) : 90 bp

chr08:4391492..4391653 (- strand) : 162 bp

3'UTR

chr08:4391050..4391491 (- strand) : 442 bp

FASTA

>Os08t0175300-01 class=Sequence position=chr08:4391050..4400757 (- strand)
GCCGCTTAAA CCCTGGTCCC CCTTGTCTCC CAAACCCTCT CTCCTTCCCC TCGCTTCCGC CTCCGGCCGC CGCCGCCGCC
GCCGCGAGGC CACCGCCTGC TGCTGCAGCG GCCTACCCTT GCGTCGGTGC AAGACGGCGC CCTGCGGCTT CGGTTGCGGG
GTGGGTGGTG GCGTTGCGGG AGGAGGAGGA GGGAGGCGGG CGGGGTCCAA GCTGAGGCGG CTCGTGAGGT CCATGGCGGT
GGCGCCGCCG CTGCCGCCGG CACCGGCGCG GCAGCTACGG CGGTGGAAGG GGTCTTCGCC GCGGCCGCCG CCGTGGCTGT
CCTCTCCCTT CCGCCGCACC CGCTACTTGT CGCGCCCGGC CTTCGCCGCG GGAGGAAGGT AGCCGTACTG TTTATTTGTG
TGTATTGCAT AAGCCTTTTT CTTTGCTAGT AGTTGTTAAG ATGTTCCGTA GTGCCTAATT CGTGATGAAA AATAAtactt
cctccgtttc acaatgtaag tcattatagt atttcccacg ttcatattga tgttaataaa tctagataaa tatatatgtc
tatattcatt aacattaata tgaatgtggg aaatgctaga atgacttaca ttgtgaaacg gagggagtaA ATGATGTTTT
GGTTAATGGA TGGGTGTATG CATATTTTTC GCATGTTCTA ATGTGATGAT TTATCTAGAC TGTGTAGGAC TTCGGATATG
TCTCCTCATT TGAGCTAGTG TCGATTAGCA TTCCTTAATC CTTATATATA TTTTTATTTT GTTTTAAGAG ATCTAAGCAT
TCCTTATGTA GTCACATTCC ACTTCTTATA GCCATACAAT TATTACTACA GAAGTACGAA TTGCCCGATA ATAGTAATCT
GCCAAAGAGT AACTAGGTTC TACTGTCACT ATCCTGAATG CCGCGCTTTT GCCTTATTAC TTGATGATTT CACATTGCTT
GGGATCTTGG GTGCTTCTGA ACTTTGCAAA TGGTTCTCGT TGGCAGGCAA GATTATTCTC CTAGTTCAGG CATGGGGGTT
AGCAAAACCG GTGCTTTCAG GCTTGGATTG TATGGCAACT TAAATGTACA AAGTAGTGTG CAAGAATGGG TTGATGAAAC
CAAGAGGTTA TTTTTCCTCA GGACCACAAA CAGTGTCAGA AACAACATCA CTAATGGCAC TACTCCTCTG CGGGTTGGAA
ATCTGCGTCA TGATCCCTCA GAAGATATCA GGAGTTCAAA CTATCCTTCC TTGTATAATC AAAGAGAAAG AGGACCATCT
AATTCAATTG TAAATAGACA TGTCGATACA GATTTGGCTA AGCATCGTGT GATGTATCAG TCAGCACATG CTGTGCCTGC
CCCATTCAGT GTTGTTAATA ATGATATCAA ACCACTGAAC ATGCTTGATG GCTCCAAGGA GGAAATTCCT TGGCACGATT
CCGTTACGAT GGAATCTTCT CTGCCTAAAG TTTCCAAGTC AGAGAAAACT TTGGTGGTTG ATAAAGCTAT CCCAGACAAA
AAGGAGCACA AACGCATTAC AAGGAAGGTG ACGCCAAATT TCCCGGACAA AGCTTCCTTG TCCACTGAGT CAAAAAATGC
ACGGAAGTTG CTTGCTACCA TCTATGACAA AGTTTTGGTT GTCGACAATG TTGAGTCAGC TAGGAGTGTT GTTAAATTGC
TTACTACAAA GTACAAAGGC TTTATTCATG CATGTGACAC GGAGGTATTT CGCCAAACCC TGCTTGAGTT CTATCATCGG
TATATCAGTT TTGGCTATGT TATTTAGGTT TTCCCTCATA ATTGTGAGAG TATCAATAAG AAGTATATTT CTGATAGGTG
ATACTATAGT ATCTTGTTTG GTCATCAATT ATTGCTGACC TCAAGTGTTT GTTGTTAGAT TGTGCCTTTT TTTCCCTATG
TATCTTCTCT GAAAATGTAA GTTGCAGAGT TTACAGGAGA TGTCATGAAG AATGTAAAAT ATTAAATGCT AATGCTAATT
ATTGGTTTCT TCTAGTTACA TGGTTTGACA TGCTCATAGT CTACTTCTGT GGTAGCAAGC TTTGCTCAGA ATTATTTACA
GTTTTATTGC GTATCAAGCT CCAAACATAC ATTCTAATTT AGGATAGTAC AATATTATAC AGGTGGCAAA TATTGATGTC
AAAGAAGAGA CACCAGTTGG TCACGGAGAA GTAATATGCT TTAGCATCTG TTCAGGAAAT TCTGATGGGG AGGCTGATTT
TGGAAATGGT AAAACATGCA TATGGGTGGA TGTGCTAGAT GGTGGAAGGG ATGTTCTAAT GGAGTTTGCT CCTTTCTTTG
AGGACCCATT TATCAAAAAG GTTCACTTCG ATTCCTCATT TATCTTGGAG TAAATTTATT GTGGTTATCT TCTCCCTTTA
TGTGTTGGAT GAAATGTATT AGTGCCATAG TTCCTTTTCC CTCTTCTATT ACTACTATAA TTACATTACT TCTTTTAGAT
TAGGCCTTAG TTGCAGCAAA CTGCACTAAA CACCATTTCC TATCACTCGT AAACTTATGC TAAACATTGA AAATAACTAG
ATATAGTTCA CTATTTTATA ATTATGCATT TCACCTGATT GTCAGCACCA TAAAGTTGTG GGTTTATAAC CAAAAAATGA
AAAACAAAAT CCTACCTGGC TACCTGCTAA ACCCTACCCA AGAGTGATAA TGTAAATGGA CTACCTTAAG ATTGCTGTTT
TAGACAGACC CTTCTGTGCT CTGACATACT GTCTTTATAT GTTCCATTTT TCCCTGCcta gaaaaaattc ctgtgcgttg
caacgagtga aggcaacttG CAAATAACTG AACAAAATTA ACTGTTTAAA CTCGGCTGTA GCTACCGGTC CATCACCTAA
TGAACTATGA AATCATGTGG GTATGATCGA TGAATATAAT TGTAACAAAA AAATGACATC ATTTCTAACA TGGTGATGGT
GTTTAGTTTT GAAGTTATGG AGTGTATTTC TTTCGTGCAA TAGCGCATGT GTGCTTGCGT CGACCAACAT GAGTCAGGTC
ATAAAAAATC TTGGTATGGT AGTCTATTTG ATTTGTAGGA GGCTTGGAGT AAATCTTAGT TAATAGTGAG GACTTGGACT
ACACTAAGGG AAGAGCCGAA AGACACATGG TAGATTGATA CCGTGTAGAA GGATTGATGT GACATGTGAC TCATTAGTGG
TGTACCAGGT CCAAAAAGTC ATGAATAAAA TATTTATAAA AATGGGAAGA GATGGAGAAA AAACATCTAT TTTTGAAAAT
CACAAGGGAA CAACTTTCAC CTCAGCCACT GTTCACGCGG GAACTGTTCA TCACCAGAGA GGTGAAGAGC TTCATGGCTA
GCTTGGGACA GTAGACCCAT CTGATCTAAG TAGGCCATGA ATTCACGATC GGTCAATGCA GCCACAGCCG GCCCAGGTAG
GGTCAGCAGG AAAAAGACCT GGCTGGGTGG AGCTAGAATT CCCTCACTCG TGTACTGCTG TACTGAAAAA GGGCGGACGT
GCGCTGTGTA CAAAGAGTCA AAGACTAATG CGGTAACTGA GTAGaggatg gacgaaaatt ttgagtacaa aatcatcttc
aatttttata atataatagg taAAGATTGA ATAGATTCAC ATTTTCGTAC CCGAGCCCCA TATTTCCTAC TACTTCGCTT
AGAAAAaaga aacatgtttt agacattgac acagtcccca aaatacaact ttgacaactt atttatgtta tagtatattt
gtagtatcaa ttgtatgacc ctataaaatt gtaatattat gatattctgg tcacaaaaac tatgttctat tacaaaatgc
taaaagaacc caatatagtt ctaatattgt ggaagtattt tttgagaaaa atctacaagt acaattttca tgtgtccaat
ctaattagtt aaaagatatt gataagaaca tttttaaagt ttgacttcaa acatgtccaa aacgagatgt ttttttgtga
ctggagggGG tagtaatttt ggtgacaaat atacacatat gagtttcata taccaagatt aaatattttg aagatattga
tggtcaaagt tctgattgtt caacttaatg tatgtccaaa acggcatgtt ttcgtgactg gagcccagag ggagtaTGAA
ATTAATATGC TAATTAGTAG ATTCAGTCTT CAATCAATCT TTGAACTGTG CAGTTCGGAA TAAAACTACA GATTGGTCAT
TACCCATCAA TTATTATTAT ACTACGTATT TGTTTCTTCT TGGCTTGTCT GAAGTGATCT GTTCTTTCTC CTCATCATGT
AGGTTTGGCA TAACTATAGT TTTGATATCC ATGTCATTGA GAACTGTGGA ATCAAGGTTG CTGGATTTCA TGCTGATACG
ATGCATCTTG CACGCCTGTG GGATTCTTCC AGGAGAACTG ATGGTGGATA TTCACTTGAA GGACTAACAA ATGATTACAG
AGTCATGGAT GCTGTTCTAA AGGACATACC TAAAACTGGG AAGGTGTCAA TGAAAACTAT CTTTGGCCGG AAAAAGGTTA
GAAAAGATGG ATCTGAAGGG AAAACCATAT CTATCGAGCC AGTCGAAAAG TTACAAAGGG AGGATAGAGA GTTGTGGATT
TGCTATTCCT CACTAGATTC AATGAGTACA TTGAAGCTTT ATGAAAGCTT GAAAAACAAG CTTGAAGCAA AGGAATGGAT
TTTCGATGAT TGTCCTAGAG GAACAATGTA TGATTTCTAC GAAGAGTATT GGCGTCCCTT TGGTGCTCTT CTTGTAAAGA
TGGAAACAGA GGGAGTGCTT GTTGACCGTG CATACCTTTC GGAGATTGAG AAAGCTGCTG TTACTGAACG AGAATTAGCA
GCGGATAAGT TTCGGAAATG GGCATCTAAG CATTGTCCTG ATGCCAAGTA CATGAATGTG AATAGTGATA ATCAAATTCG
CCAACTTTTC TTTGGTGGCA TCGAAAATAG GTATTCCTAC CACCTTGTAT AATCTCTTTG ATGTCTGCTT GATTTGTATA
TACTTTATGC CAGGATATCT TTTTGAATGC ATGTCATTTA GAAACCACTG TAAAAGGATA TCATTAATAT GTGTTAAAAC
CAATAATTGC TTGCTGTTCT TATATGCATT GGTCTATGCA TGGTTTAAAC TGGTTAGCAA TTGTTCTTGT GTGTCCAACA
CTCCAAGACA TGAATAATTC TTCATATCAA CAAGTGGTGG AAAACGAGGG AATCTATCTT TGCCTTCTAT TTGTGCTAGG
TATTTCCTTT ATGTAATTTC AAAGAAAAAG TAGTAACTGT GAGTTATTGC TTGTGCGTAT TTCCTGTAAA AATGATTGTT
TTCTTTACAT TTACCTGCTT ATCATTGCTT ATGTATAATT CTTGTCAACT TCACAATCTT TGTCACAGAA ATAAGCGTGG
TGAAACTTGG CCACAAAGTA AAACTTTTAA AGTGCCAAAT GATGAAGGCA TAGCTACAGA GGGCAAGAAG ACTCCAAAGT
CTCGCACAAT CAAACTTTTC ACTATTGTGG AAGATCTTAA AATTGATATG TTCACCCCGA CTGGTTGGCC TTCAGTCAGT
GGGGACGTTT TAAGGAGTTT GGCTGGTAAA ATACCCACAG ATCATATATA TAAAATTGAT GATGGCCAAG AGTTTGATGA
AGATGGGAGC AGTTTGGAAC TTCCTGAGCA GGATATAGAA GACACTTCCC CATATGGAAC TGCATATGAA GCGTTTGGTG
GAGGAAAGAA GGGAAGGGAA GCATGTCATG CCATTGCTGC TCTATGTGAA GTCTTTTCTA TTGACAAATT GATATCCGGC
TTCATTGTTC CATTGCAGGT GAGCCAGGAT CTTAGTCATG CTGATTGAAG TTGCCATTCT TAAGACATCA CTCATTGCAT
GTACTTATAA ATGATAATGC AAATCAATTT GTGCTGGTGT TATGTGTCCT GAGTCCTGAC AGCTCCAATG TTCTTTCACC
TCACGCTCTT GAAACTTTGG GGCTGCAGCA TGCACCATAA ATGTGGTGAT TTGGTCAGCA TGCAATTTTT GTAGGGAGAG
CATGGAATTC AGTTAAATGC ATTTTCAGTC CATCAAGTTT GAAATTTGGT TCTTTCGATT AGTGCTGTTT GATATCTTAA
TTTGATAATT TAATACTTTG TTTATACCAT GATCACTTGG TCTGTTTTGA TTATATATTT TGAGGCTTAA TGGTGCTACT
ACTGTAGTCT TGGTGCTGAT CCAACTTGTG TTGTTTGTGT GAGGGACAAC TATGGTGTAT ACTTGGTGCA TGATACCAAT
AGTCTCAGCT AACTGCACTT AACTTCTAAG TTGCACCTAC TGTTTGAGTC TTGACTGCTC TTTATCCATG ATAGGGAGAT
CGTATATCAT GCAAGGAAGG GCGCATTCAC TGTTCATTAA ATATCAATAC TGAAACAGGA CGCTTGTCAG CAAGAACACC
AAACTTACAG GTATGCCTCT TCTTTTGCAT TTGTTGGAAT CTTGCATCAG TACCTCACAG TTCACATTTG GGTTGTCAAT
AAGCACATGA TGATGGTACA CCACACTATT GTCAAGTAAA GGATGAAAAA TATACAAAAG GTCTGTATGT TCTTTCAAGA
CAAAAGTATG TTGGTGTCGG CTCCTTCTCA CTGACTTTTG CCTGGTTTGA GTGTGCTCTA CCACTGTGTA TGTAAGCAGT
ATAAGACTGC TGTTCCACAG AGTCACTATA TGAGTGTTTT TCAGAGTATA TGCTTGCATT CTTATTTGCA TCAACTTGCC
ACCGACTGCT ACAGAAGGGA GACTTGGACT GCTTAGCAAC TAAGTTGCAT ATGCTATCAA TTTCGATTTT TCGTAAAGCA
CAGGAACTAA TGTTACCTTC AAACTTCAGC ATTCACCAGT TGCAATATAA ATAAAATGCT CTGTAGAAGT ATGATACTCC
ATAATCATTT TATTCATTCA TCAATGGATA TGAGAATGAA AGGCAAAACA AACATGGCAA ATTGGCAATA TAAAGTAGGA
ATGATGAAAT GGCTCACCGG CAAACTTATT TTGTGTAGCC AACCTCAGGC ATCAGGACAC ACATTTGAAT TATTCATTTA
GTCAATAAGC TGTCTGCTAT TTCGGGATAT TTGATTATTA CCATGCTTCA TCATCAAGGG TATTTGGACC CTTGCTAAAT
TTGTTATTAC TTCTGACAAA TGCTTCAGTT TTTATTGTTA GAGTGGTGCT ATATCGATTA TGTAAATTTT ATTTTTTTTT
AACCAAGTAT ATCTTCCTTG CAGAATCAAC CTGCTCTTGA AAAGGATAGG TACAAGATTC GCCATGCTTT TGTCGCAGCT
CCAGGGAACA CTCTTATTGT TGCTGATTAT GGCCAAGTAT GCTTAGTGGT TCTCAATAGT AAGTTTTTTT ACTTCACTTA
GCAGTTCCAC CTGATAAAAG GTCTTTTTTT ATGTAGCTGG AACTGAGGAT CTTGGCGCAT CTTACTAATT GTAAAAGCAT
GCTGGAAGCT TTCAAGGCTG GTGGTGACTT CCATTCTAGG ACAGCCATGA ATATGTACCA GCATGTTCGT GATGCTGTTG
AAGAAAAGAA AGTTCTGCTT GAATGGCATC CTCAACCAGG TCAAGACAAA CCCCCAGTGC CATTATTGAA GGTACTTGAG
TGTCACTAAC ATTTTCTGAC AGCAGCTTAT CTCTCGAAGT TGTACTTGAT TTCATTTGAA TTACGTAAGA TTTTGGTCCT
GTTTGCTTAT TGTGATAAGA TGGAATATGA TTACCTTCAT TTGTAGTTCA TTCAGTCAAA TTTTAATTAT TTTAGTTATT
GAGAAATATA TCTTTGTTGC ATTTTTTTTT AAAAAAAAAT TGAACATGTG AATTCTGTGA CAGTTGTTCC TAGTGGAAAG
CCACATAATT TGTCGGATAA CATGTCTAAA TTACACAAAA AAGTGTCGGA TTTAATTTAA TCGAAAGATA CATGGATAAT
TGATAACCTC ACTTGTCATA CATTTATATG TTAGGGCCTC GTGTTTTCTT TCTGCTTTGA AGAAGTTGGC AAGTTGCATA
GAGTGCTTTT ATCAATTGTT ATTGGGCATA TATATTCCAT ATGTACTGAT TTTTTTATAT ATATATCTGG ACCCCTGGTA
GAATGGTATA AGGCTATATA CTAATAGGCA TGGAGTTAAA ACCAAACTTG ATGTTTCTAT TTCTATTTTA GGATGCTTTT
GGCGCTGAGA GGAGGAAGGC CAAAATGCTT AATTTCTCCA TTGCATATGG GAAGACTGCT GTTGGTCTAT CTTGGGATTG
GAAGGTATGG GCTTCTATTT GTACAGGCTT GTGCATGCAT TTATCATCTT CCCTTGTTCA GTTTTTCTTA TTGGGTTTCA
TCTTGTTTTT GTACCCAACA TGATATCGCA TAGGAGTATT ATTCAGTAAA AGTTTTGTTA CAATCAGTTC CAGAGTTGTA
GCTTAATTGT CCTAGCAGGT TTCTGTTAGG GAAGCAAGGG ATACACTCAA ACTTTGGTAT AGGGATAGAA AGGAAGTTTC
AGCTTGGCAA AAGAAGCAGA AAGCCTTTGC GCTTGAAAAG TGCGAAGTCT ACACTTTGCT CGGGCGATCA CGCCAATTTC
CTAATATGAC TCATGCGGGT CCTGGTCAAA AGGGTCACGT CGAGCGTGCT GCTATAAATG CACCAGTGCA GGTAATTCCT
ATTAGTTATA TCACAATGGT TGTTCTTGTT CAGTTTTGGG ATGTCTAAAT CCCTTTTGTG ATACACAGGG CAGTGCAGCA
GATGTTGCTA TGTGTGCAAT GCTTGAGATA GAAAGAAACG CTCGCCTTAA GGAGCTTGGT TGGAGACTCC TATTGCAGGT
TTATGACAAT AACACTCCTA CGTTTACAAA AGAAAGTACT TAGGCTGGTA TTTGAAGGCA CAGACGAAGG GGGCCACCAT
TGTTTCTTTC TTTCAAAGAA TTTGGCAAAG CAAAGATTTA CATCATATTT AAGAGCTACT TTTTGTGTTC TTTCAGAGTA
TTTTATTTTG ATCCCCCGAA TGAATTTGTA CATTGTCCTC AAATGTTATG TCTGCATTTG CCAGGTGCAT GATGAAGTAA
TCTTGGAGGG GCCTACAGAA TCTGCCGAGG AAGCCAAGAC CATCGTTGTG GAGTGCATGT CCAAGCCTTT CTATGGAACC
AACATCCTCA AGGTCGACCT AGCTGTCGAC GCCAAGTACG CGAAGAGCTG GTATGCTGCC AAGTAGTAGA ATCCGCACTC
GGTTCTTCTG CCCTATACAT AGCCAGATGA GCACATTTGT CTGCCCCAAA GTTAGGCGAC ACCAAAGTTA TGTGTCGCCG
ATGCGATGAA GACTCTGCCC ATCCGTCCTG ACGAAATACA GCGGACTGAA CCAGCACAGA TAGAGATGCA AGCCGCTCAA
GAAGTTGAAG TGCCACCCCC ATCACCCACA GGAACACAAG ACCACACGTC CATTTTTCGG TGGCAGAGGC AGAGCATCCA
AGAACCGAAT AGGCTGAAGA CTCTTTCACT GGCAGTAGCT GAATGTACAC TAGTAGCCTG TCCGATAGTT ACTCCATTAG
ATTTGGATTT GACTGTAGAG ACCACAGTAG ATACTGACCT GTATGAGACT TTCAGATACT TGATCATGAA GGAAGTGCAG
AAGCATGCTG TCTTCATATG ACCTGTTC

Locus: Os08g0175300

Loading...

Locus: Os08g0175300

Loading...