Os08t0175300-02

Locus

Os08g0175300

Description

Similar to PolI-like DNA polymerase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

PolI-like, OsPoLP1, PoLP1, OsRpoLp, RpoLp

Oryzabase Gene Name Synonym(s)

PolI-like DNA polymerase, plastidal DNA polymerase 1

Transcript Evidence

AK064462 (DDBJ, Best hit)

Protein Evidence

Q8S9E2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: DNA replication (GO:0006260)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: DNA-directed DNA polymerase activity (GO:0003887)

Functional domain (InterPro)

DNA-directed DNA polymerase, family A, palm domain (IPR001098)

DNA polymerase A (IPR002298)

Full-length cDNA

002-110-G06 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0175300-02)

RiceXPro (AK064462)

Others

Oryzabase (19597)

KEGG (Os08t0175300-02)

Transcript

1787 bp

>Os08t0175300-02 Similar to PolI-like DNA polymerase.
CATGGATGCTGTTCTAAAGGACATACCTAAAACTGGGAAGGTGTCAATGAAAACTATCTT
TGGCCGGAAAAAGGTTAGAAAAGATGGATCTGAAGGGAAAACCATATCTATCGAGCCAGT
CGAAAAGTTACAAAGGGAGGATAGAGAGTTGTGGATTTGCTATTCCTCACTAGATTCAAT
GAGTACATTGAAGCTTTATGAAAGCTTGAAAAACAAGCTTGAAGCAAAGGAATGGATTTT
CGATGATTGTCCTAGAGGAACAATGTATGATTTCTACGAAGAGTATTGGCGTCCCTTTGG
TGCTCTTCTTGTAAAGATGGAAACAGAGGGAGTGCTTGTTGACCGTGCATACCTTTCGGA
GATTGAGAAAGCTGCTGTTACTGAACGAGAATTAGCAGCGGATAAGTTTCGGAAATGGGC
ATCTAAGCATTGTCCTGATGCCAAGTACATGAATGTGAATAGTGATAATCAAATTCGCCA
ACTTTTCTTTGGTGGCATCGAAAATAGAAATAAGCGTGGTGAAACTTGGCCACAAAGTAA
AACTTTTAAAGTGCCAAATGATGAAGGCATAGCTACAGAGGGCAAGAAGACTCCAAAGTC
TCGCACAATCAAACTTTTCACTATTGTGGAAGATCTTAAAATTGATATGTTCACCCCGAC
TGGTTGGCCTTCAGTCAGTGGGGACGTTTTAAGGAGTTTGGCTGGTAAAATACCCACAGA
TCATATATATAAAATTGATGATGGCCAAGAGTTTGATGAAGATGGGAGCAGTTTGGAACT
TCCTGAGCAGGATATAGAAGACACTTCCCCATATGGAACTGCATATGAAGCGTTTGGTGG
AGGAAAGAAGGGAAGGGAAGCATGTCATGCCATTGCTGCTCTATGTGAAGTCTTTTCTAT
TGACAAATTGATATCCGGCTTCATTGTTCCATTGCAGGGAGATCGTATATCATGCAAGGA
AGGGCGCATTCACTGTTCATTAAATATCAATACTGAAACAGGACGCTTGTCAGCAAGAAC
ACCAAACTTACAGAATCAACCTGCTCTTGAAAAGGATAGGTACAAGATTCGCCATGCTTT
TGTCGCAGCTCCAGGGAACACTCTTATTGTTGCTGATTATGGCCAACTGGAACTGAGGAT
CTTGGCGCATCTTACTAATTGTAAAAGCATGCTGGAAGCTTTCAAGGCTGGTGGTGACTT
CCATTCTAGGACAGCCATGAATATGTACCAGCATGTTCGTGATGCTGTTGAAGAAAAGAA
AGTTCTGCTTGAATGGCATCCTCAACCAGGTCAAGACAAACCCCCAGTGCCATTATTGAA
GGATGCTTTTGGCGCTGAGAGGAGGAAGGCCAAAATGCTTAATTTCTCCATTGCATATGG
GAAGACTGCTGTTGGTCTATCTTGGGATTGGAAGGTTTCTGTTAGGGAAGCAAGGGATAC
ACTCAAACTTTGGTATAGGGATAGAAAGGAAGTTTCAGCTTGGCAAAAGAAGCAGAAAGC
CTTTGCGCTTGAAAAGTGCGAAGTCTACACTTTGCTCGGGCGATCACGCCAATTTCCTAA
TATGACTCATGCGGGTCCTGGTCAAAAGGGTCACGTCGAGCGTGCTGCTATAAATGCACC
AGTGCAGGGCAGTGCAGCAGATGTTGCTATGTGTGCAATGCTTGAGATAGAAAGAAACGC
TCGCCTTAAGGAGCTTGGTTAGAGACCACAGTAGATACTGACCTGTATGAGACTTTCAGA
TACTTGATCATGAAGGAAGTGCAGAAGCATGCTGTCTTCATATGACC

CDS

1701 bp

>Os08t0175300-02 Similar to PolI-like DNA polymerase.
ATGGATGCTGTTCTAAAGGACATACCTAAAACTGGGAAGGTGTCAATGAAAACTATCTTT
GGCCGGAAAAAGGTTAGAAAAGATGGATCTGAAGGGAAAACCATATCTATCGAGCCAGTC
GAAAAGTTACAAAGGGAGGATAGAGAGTTGTGGATTTGCTATTCCTCACTAGATTCAATG
AGTACATTGAAGCTTTATGAAAGCTTGAAAAACAAGCTTGAAGCAAAGGAATGGATTTTC
GATGATTGTCCTAGAGGAACAATGTATGATTTCTACGAAGAGTATTGGCGTCCCTTTGGT
GCTCTTCTTGTAAAGATGGAAACAGAGGGAGTGCTTGTTGACCGTGCATACCTTTCGGAG
ATTGAGAAAGCTGCTGTTACTGAACGAGAATTAGCAGCGGATAAGTTTCGGAAATGGGCA
TCTAAGCATTGTCCTGATGCCAAGTACATGAATGTGAATAGTGATAATCAAATTCGCCAA
CTTTTCTTTGGTGGCATCGAAAATAGAAATAAGCGTGGTGAAACTTGGCCACAAAGTAAA
ACTTTTAAAGTGCCAAATGATGAAGGCATAGCTACAGAGGGCAAGAAGACTCCAAAGTCT
CGCACAATCAAACTTTTCACTATTGTGGAAGATCTTAAAATTGATATGTTCACCCCGACT
GGTTGGCCTTCAGTCAGTGGGGACGTTTTAAGGAGTTTGGCTGGTAAAATACCCACAGAT
CATATATATAAAATTGATGATGGCCAAGAGTTTGATGAAGATGGGAGCAGTTTGGAACTT
CCTGAGCAGGATATAGAAGACACTTCCCCATATGGAACTGCATATGAAGCGTTTGGTGGA
GGAAAGAAGGGAAGGGAAGCATGTCATGCCATTGCTGCTCTATGTGAAGTCTTTTCTATT
GACAAATTGATATCCGGCTTCATTGTTCCATTGCAGGGAGATCGTATATCATGCAAGGAA
GGGCGCATTCACTGTTCATTAAATATCAATACTGAAACAGGACGCTTGTCAGCAAGAACA
CCAAACTTACAGAATCAACCTGCTCTTGAAAAGGATAGGTACAAGATTCGCCATGCTTTT
GTCGCAGCTCCAGGGAACACTCTTATTGTTGCTGATTATGGCCAACTGGAACTGAGGATC
TTGGCGCATCTTACTAATTGTAAAAGCATGCTGGAAGCTTTCAAGGCTGGTGGTGACTTC
CATTCTAGGACAGCCATGAATATGTACCAGCATGTTCGTGATGCTGTTGAAGAAAAGAAA
GTTCTGCTTGAATGGCATCCTCAACCAGGTCAAGACAAACCCCCAGTGCCATTATTGAAG
GATGCTTTTGGCGCTGAGAGGAGGAAGGCCAAAATGCTTAATTTCTCCATTGCATATGGG
AAGACTGCTGTTGGTCTATCTTGGGATTGGAAGGTTTCTGTTAGGGAAGCAAGGGATACA
CTCAAACTTTGGTATAGGGATAGAAAGGAAGTTTCAGCTTGGCAAAAGAAGCAGAAAGCC
TTTGCGCTTGAAAAGTGCGAAGTCTACACTTTGCTCGGGCGATCACGCCAATTTCCTAAT
ATGACTCATGCGGGTCCTGGTCAAAAGGGTCACGTCGAGCGTGCTGCTATAAATGCACCA
GTGCAGGGCAGTGCAGCAGATGTTGCTATGTGTGCAATGCTTGAGATAGAAAGAAACGCT
CGCCTTAAGGAGCTTGGTTAG

Protein

567 aa

>Os08t0175300-02 Similar to PolI-like DNA polymerase.
MDAVLKDIPKTGKVSMKTIFGRKKVRKDGSEGKTISIEPVEKLQREDRELWICYSSLDSM
STLKLYESLKNKLEAKEWIFDDCPRGTMYDFYEEYWRPFGALLVKMETEGVLVDRAYLSE
IEKAAVTERELAADKFRKWASKHCPDAKYMNVNSDNQIRQLFFGGIENRNKRGETWPQSK
TFKVPNDEGIATEGKKTPKSRTIKLFTIVEDLKIDMFTPTGWPSVSGDVLRSLAGKIPTD
HIYKIDDGQEFDEDGSSLELPEQDIEDTSPYGTAYEAFGGGKKGREACHAIAALCEVFSI
DKLISGFIVPLQGDRISCKEGRIHCSLNINTETGRLSARTPNLQNQPALEKDRYKIRHAF
VAAPGNTLIVADYGQLELRILAHLTNCKSMLEAFKAGGDFHSRTAMNMYQHVRDAVEEKK
VLLEWHPQPGQDKPPVPLLKDAFGAERRKAKMLNFSIAYGKTAVGLSWDWKVSVREARDT
LKLWYRDRKEVSAWQKKQKAFALEKCEVYTLLGRSRQFPNMTHAGPGQKGHVERAAINAP
VQGSAADVAMCAMLEIERNARLKELG*

5'UTR

chr08:4396274..4396274 (- strand) : 1 bp

CDS

chr08:4395768..4396273 (- strand) : 506 bp

chr08:4394900..4395329 (- strand) : 430 bp

chr08:4394268..4394363 (- strand) : 96 bp

chr08:4393362..4393454 (- strand) : 93 bp

chr08:4393087..4393281 (- strand) : 195 bp

chr08:4392434..4392526 (- strand) : 93 bp

chr08:4392047..4392259 (- strand) : 213 bp

chr08:4391897..4391969 (- strand) : 73 bp

chr08:4391140..4391141 (- strand) : 2 bp

3'UTR

chr08:4391055..4391139 (- strand) : 85 bp

FASTA

>Os08t0175300-02 class=Sequence position=chr08:4391055..4396274 (- strand)
CATGGATGCT GTTCTAAAGG ACATACCTAA AACTGGGAAG GTGTCAATGA AAACTATCTT TGGCCGGAAA AAGGTTAGAA
AAGATGGATC TGAAGGGAAA ACCATATCTA TCGAGCCAGT CGAAAAGTTA CAAAGGGAGG ATAGAGAGTT GTGGATTTGC
TATTCCTCAC TAGATTCAAT GAGTACATTG AAGCTTTATG AAAGCTTGAA AAACAAGCTT GAAGCAAAGG AATGGATTTT
CGATGATTGT CCTAGAGGAA CAATGTATGA TTTCTACGAA GAGTATTGGC GTCCCTTTGG TGCTCTTCTT GTAAAGATGG
AAACAGAGGG AGTGCTTGTT GACCGTGCAT ACCTTTCGGA GATTGAGAAA GCTGCTGTTA CTGAACGAGA ATTAGCAGCG
GATAAGTTTC GGAAATGGGC ATCTAAGCAT TGTCCTGATG CCAAGTACAT GAATGTGAAT AGTGATAATC AAATTCGCCA
ACTTTTCTTT GGTGGCATCG AAAATAGGTA TTCCTACCAC CTTGTATAAT CTCTTTGATG TCTGCTTGAT TTGTATATAC
TTTATGCCAG GATATCTTTT TGAATGCATG TCATTTAGAA ACCACTGTAA AAGGATATCA TTAATATGTG TTAAAACCAA
TAATTGCTTG CTGTTCTTAT ATGCATTGGT CTATGCATGG TTTAAACTGG TTAGCAATTG TTCTTGTGTG TCCAACACTC
CAAGACATGA ATAATTCTTC ATATCAACAA GTGGTGGAAA ACGAGGGAAT CTATCTTTGC CTTCTATTTG TGCTAGGTAT
TTCCTTTATG TAATTTCAAA GAAAAAGTAG TAACTGTGAG TTATTGCTTG TGCGTATTTC CTGTAAAAAT GATTGTTTTC
TTTACATTTA CCTGCTTATC ATTGCTTATG TATAATTCTT GTCAACTTCA CAATCTTTGT CACAGAAATA AGCGTGGTGA
AACTTGGCCA CAAAGTAAAA CTTTTAAAGT GCCAAATGAT GAAGGCATAG CTACAGAGGG CAAGAAGACT CCAAAGTCTC
GCACAATCAA ACTTTTCACT ATTGTGGAAG ATCTTAAAAT TGATATGTTC ACCCCGACTG GTTGGCCTTC AGTCAGTGGG
GACGTTTTAA GGAGTTTGGC TGGTAAAATA CCCACAGATC ATATATATAA AATTGATGAT GGCCAAGAGT TTGATGAAGA
TGGGAGCAGT TTGGAACTTC CTGAGCAGGA TATAGAAGAC ACTTCCCCAT ATGGAACTGC ATATGAAGCG TTTGGTGGAG
GAAAGAAGGG AAGGGAAGCA TGTCATGCCA TTGCTGCTCT ATGTGAAGTC TTTTCTATTG ACAAATTGAT ATCCGGCTTC
ATTGTTCCAT TGCAGGTGAG CCAGGATCTT AGTCATGCTG ATTGAAGTTG CCATTCTTAA GACATCACTC ATTGCATGTA
CTTATAAATG ATAATGCAAA TCAATTTGTG CTGGTGTTAT GTGTCCTGAG TCCTGACAGC TCCAATGTTC TTTCACCTCA
CGCTCTTGAA ACTTTGGGGC TGCAGCATGC ACCATAAATG TGGTGATTTG GTCAGCATGC AATTTTTGTA GGGAGAGCAT
GGAATTCAGT TAAATGCATT TTCAGTCCAT CAAGTTTGAA ATTTGGTTCT TTCGATTAGT GCTGTTTGAT ATCTTAATTT
GATAATTTAA TACTTTGTTT ATACCATGAT CACTTGGTCT GTTTTGATTA TATATTTTGA GGCTTAATGG TGCTACTACT
GTAGTCTTGG TGCTGATCCA ACTTGTGTTG TTTGTGTGAG GGACAACTAT GGTGTATACT TGGTGCATGA TACCAATAGT
CTCAGCTAAC TGCACTTAAC TTCTAAGTTG CACCTACTGT TTGAGTCTTG ACTGCTCTTT ATCCATGATA GGGAGATCGT
ATATCATGCA AGGAAGGGCG CATTCACTGT TCATTAAATA TCAATACTGA AACAGGACGC TTGTCAGCAA GAACACCAAA
CTTACAGGTA TGCCTCTTCT TTTGCATTTG TTGGAATCTT GCATCAGTAC CTCACAGTTC ACATTTGGGT TGTCAATAAG
CACATGATGA TGGTACACCA CACTATTGTC AAGTAAAGGA TGAAAAATAT ACAAAAGGTC TGTATGTTCT TTCAAGACAA
AAGTATGTTG GTGTCGGCTC CTTCTCACTG ACTTTTGCCT GGTTTGAGTG TGCTCTACCA CTGTGTATGT AAGCAGTATA
AGACTGCTGT TCCACAGAGT CACTATATGA GTGTTTTTCA GAGTATATGC TTGCATTCTT ATTTGCATCA ACTTGCCACC
GACTGCTACA GAAGGGAGAC TTGGACTGCT TAGCAACTAA GTTGCATATG CTATCAATTT CGATTTTTCG TAAAGCACAG
GAACTAATGT TACCTTCAAA CTTCAGCATT CACCAGTTGC AATATAAATA AAATGCTCTG TAGAAGTATG ATACTCCATA
ATCATTTTAT TCATTCATCA ATGGATATGA GAATGAAAGG CAAAACAAAC ATGGCAAATT GGCAATATAA AGTAGGAATG
ATGAAATGGC TCACCGGCAA ACTTATTTTG TGTAGCCAAC CTCAGGCATC AGGACACACA TTTGAATTAT TCATTTAGTC
AATAAGCTGT CTGCTATTTC GGGATATTTG ATTATTACCA TGCTTCATCA TCAAGGGTAT TTGGACCCTT GCTAAATTTG
TTATTACTTC TGACAAATGC TTCAGTTTTT ATTGTTAGAG TGGTGCTATA TCGATTATGT AAATTTTATT TTTTTTTAAC
CAAGTATATC TTCCTTGCAG AATCAACCTG CTCTTGAAAA GGATAGGTAC AAGATTCGCC ATGCTTTTGT CGCAGCTCCA
GGGAACACTC TTATTGTTGC TGATTATGGC CAAGTATGCT TAGTGGTTCT CAATAGTAAG TTTTTTTACT TCACTTAGCA
GTTCCACCTG ATAAAAGGTC TTTTTTTATG TAGCTGGAAC TGAGGATCTT GGCGCATCTT ACTAATTGTA AAAGCATGCT
GGAAGCTTTC AAGGCTGGTG GTGACTTCCA TTCTAGGACA GCCATGAATA TGTACCAGCA TGTTCGTGAT GCTGTTGAAG
AAAAGAAAGT TCTGCTTGAA TGGCATCCTC AACCAGGTCA AGACAAACCC CCAGTGCCAT TATTGAAGGT ACTTGAGTGT
CACTAACATT TTCTGACAGC AGCTTATCTC TCGAAGTTGT ACTTGATTTC ATTTGAATTA CGTAAGATTT TGGTCCTGTT
TGCTTATTGT GATAAGATGG AATATGATTA CCTTCATTTG TAGTTCATTC AGTCAAATTT TAATTATTTT AGTTATTGAG
AAATATATCT TTGTTGCATT TTTTTTTAAA AAAAAATTGA ACATGTGAAT TCTGTGACAG TTGTTCCTAG TGGAAAGCCA
CATAATTTGT CGGATAACAT GTCTAAATTA CACAAAAAAG TGTCGGATTT AATTTAATCG AAAGATACAT GGATAATTGA
TAACCTCACT TGTCATACAT TTATATGTTA GGGCCTCGTG TTTTCTTTCT GCTTTGAAGA AGTTGGCAAG TTGCATAGAG
TGCTTTTATC AATTGTTATT GGGCATATAT ATTCCATATG TACTGATTTT TTTATATATA TATCTGGACC CCTGGTAGAA
TGGTATAAGG CTATATACTA ATAGGCATGG AGTTAAAACC AAACTTGATG TTTCTATTTC TATTTTAGGA TGCTTTTGGC
GCTGAGAGGA GGAAGGCCAA AATGCTTAAT TTCTCCATTG CATATGGGAA GACTGCTGTT GGTCTATCTT GGGATTGGAA
GGTATGGGCT TCTATTTGTA CAGGCTTGTG CATGCATTTA TCATCTTCCC TTGTTCAGTT TTTCTTATTG GGTTTCATCT
TGTTTTTGTA CCCAACATGA TATCGCATAG GAGTATTATT CAGTAAAAGT TTTGTTACAA TCAGTTCCAG AGTTGTAGCT
TAATTGTCCT AGCAGGTTTC TGTTAGGGAA GCAAGGGATA CACTCAAACT TTGGTATAGG GATAGAAAGG AAGTTTCAGC
TTGGCAAAAG AAGCAGAAAG CCTTTGCGCT TGAAAAGTGC GAAGTCTACA CTTTGCTCGG GCGATCACGC CAATTTCCTA
ATATGACTCA TGCGGGTCCT GGTCAAAAGG GTCACGTCGA GCGTGCTGCT ATAAATGCAC CAGTGCAGGT AATTCCTATT
AGTTATATCA CAATGGTTGT TCTTGTTCAG TTTTGGGATG TCTAAATCCC TTTTGTGATA CACAGGGCAG TGCAGCAGAT
GTTGCTATGT GTGCAATGCT TGAGATAGAA AGAAACGCTC GCCTTAAGGA GCTTGGTTGG AGACTCCTAT TGCAGGTTTA
TGACAATAAC ACTCCTACGT TTACAAAAGA AAGTACTTAG GCTGGTATTT GAAGGCACAG ACGAAGGGGG CCACCATTGT
TTCTTTCTTT CAAAGAATTT GGCAAAGCAA AGATTTACAT CATATTTAAG AGCTACTTTT TGTGTTCTTT CAGAGTATTT
TATTTTGATC CCCCGAATGA ATTTGTACAT TGTCCTCAAA TGTTATGTCT GCATTTGCCA GGTGCATGAT GAAGTAATCT
TGGAGGGGCC TACAGAATCT GCCGAGGAAG CCAAGACCAT CGTTGTGGAG TGCATGTCCA AGCCTTTCTA TGGAACCAAC
ATCCTCAAGG TCGACCTAGC TGTCGACGCC AAGTACGCGA AGAGCTGGTA TGCTGCCAAG TAGTAGAATC CGCACTCGGT
TCTTCTGCCC TATACATAGC CAGATGAGCA CATTTGTCTG CCCCAAAGTT AGGCGACACC AAAGTTATGT GTCGCCGATG
CGATGAAGAC TCTGCCCATC CGTCCTGACG AAATACAGCG GACTGAACCA GCACAGATAG AGATGCAAGC CGCTCAAGAA
GTTGAAGTGC CACCCCCATC ACCCACAGGA ACACAAGACC ACACGTCCAT TTTTCGGTGG CAGAGGCAGA GCATCCAAGA
ACCGAATAGG CTGAAGACTC TTTCACTGGC AGTAGCTGAA TGTACACTAG TAGCCTGTCC GATAGTTACT CCATTAGATT
TGGATTTGAC TGTAGAGACC ACAGTAGATA CTGACCTGTA TGAGACTTTC AGATACTTGA TCATGAAGGA AGTGCAGAAG
CATGCTGTCT TCATATGACC 

Locus: Os08g0175300

Loading...

Locus: Os08g0175300

Loading...