Os08t0176200-01

Locus

Os08g0176200

Description

Serine/threonine protein kinase-related domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

ORK1, OsRLCK246, RLCK246

Oryzabase Gene Name Synonym(s)

Oryza sativa Receptor-like Kinase1, Receptor-like Kinase 1, Receptor-like Cytoplasmic Kinase 246

Transcript Evidence

AK241001 (DDBJ, Best hit)

Protein Evidence

Q5KS46 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Concanavalin A-like lectin/glucanase, subgroup (IPR013320)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J065053D05 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0176200-01)

Others

Oryzabase (13200)

KEGG (Os08t0176200-01)

Transcript

1520 bp

>Os08t0176200-01 Serine/threonine protein kinase-related domain containing protein.
CCCCTCTTTTTTTTTTTTTTTTTGGCAGGGAGGTCATCTCGTACTGGAGCAATTTCTGGT
GGAGTGGCTGCTGGAGCAGCCTTGCTATTTAATATTCCTGCTATTGGTTTTGCCTGGTGG
CGACGCAGGAAACCCCAAGAGTATTTTCCTGTTGTACCTGGGGTCCATCTTGGCCAGCTT
AAAAGATTTTCGCTACGAGAACTTCAAGTTGCAACAAAGACCTTCAACAATAAAAACATT
CTTGGCACAGGCGGTTTTAGCAAGGTCTATAAAGGAAGACTAGCAGATGGTTCTTTAGTA
GCTGTTAAGAGACTAAAGGAGCAGAGAACACCTGGTGGGGAACTACAGTTTCAAACAGAA
GTTGAGATGATTAGCATGGCTTTACATAGAAATCTGTTGCGTTTACGTGGGTTCTGTATG
ACACCCACAGAAAGGTTGCTTGTGTATCCATACATGGCTAATGGAAGTGTTGCTTCACGT
CTGAGAGAACGACCACCATCTGAACCTCCACTTGATTGGCAAACAAGAAGAAGGATCGCA
GCAGGTTCTGCCAGGGGGCTGTCCTATTTACATGATCATTGCAACCCAAAGATCATCCAT
CGTGATGTCAAAGCGGCAAATATTTTATTAGATGAAGACTTTGAAGCTGTATTTGGAGAT
TTTGGTTTGGCCAAACCAATGGATTACAAGGATACCCATGTAACAACTGCAGTACATGGA
ACAATTGGACATATTGCACCAGAATATCTTTCAACAGGAATTCTCTCTGAGAAAACTGAT
GTATTTGGCTATGGAATCATGCTTTTGGAGCTTATTACAGGAAAACGTGCCTTTGATCTT
GCTCTTCTAGCCAGAGGTGAGGGTGTCATGCCACTGGACTGGGTCAAACGATTAATCAAG
GAGGAAAAGCTGGAGAAATTGATTGATCCAGATCTACAGAACAAGTACATTGATGCTGAG
GTAGAATCACTAATCCAGGTCGCGCTTCTTTGCACACAAGGCTCCCCTCTGGAACGCCCC
AAGATGGCTGCGGTGGTGAGGATGCTTGATGAAGGTGATGGCCTTGCTGAAAGATGGAAG
GAGTGGCAGAAGATAGAAATAGTACAGCAGGACGTGGAGCTTGGCCTGTATCAGAATGGT
TGGACTGTTGACTCAACTGAGAACCTCCATGCGGTCGAGTTATCAGGGCCAAGGTGATGA
ATGCTCACCGGTAACTTTCTGCTGATTCTTGTACATCGGAAGAGCAATTCGTACTGATCA
CCCTAGTCGAATCACCATCTGTTCATATTTGTTTGATGTATAATGCTTTTTCTTGCTCGA
CGCACAACCATGGACATTGCCATATTGGTGCCACGGAAACAGCACAACCCGAGGAACTAG
TGTCCTGAGTGGTTGCTGCAACAATGTCCCAGTATGTTAAACCTACAATTTAGTAGGATG
GAACTGGGTATCATTTTTGCCTCCTTTGGGAAGGCTTCAGATGATGCAATTGCCCATGGT
GTACTTTTATTTGGGCATTT

CDS

1197 bp

>Os08t0176200-01 Serine/threonine protein kinase-related domain containing protein.
CCCCTCTTTTTTTTTTTTTTTTTGGCAGGGAGGTCATCTCGTACTGGAGCAATTTCTGGT
GGAGTGGCTGCTGGAGCAGCCTTGCTATTTAATATTCCTGCTATTGGTTTTGCCTGGTGG
CGACGCAGGAAACCCCAAGAGTATTTTCCTGTTGTACCTGGGGTCCATCTTGGCCAGCTT
AAAAGATTTTCGCTACGAGAACTTCAAGTTGCAACAAAGACCTTCAACAATAAAAACATT
CTTGGCACAGGCGGTTTTAGCAAGGTCTATAAAGGAAGACTAGCAGATGGTTCTTTAGTA
GCTGTTAAGAGACTAAAGGAGCAGAGAACACCTGGTGGGGAACTACAGTTTCAAACAGAA
GTTGAGATGATTAGCATGGCTTTACATAGAAATCTGTTGCGTTTACGTGGGTTCTGTATG
ACACCCACAGAAAGGTTGCTTGTGTATCCATACATGGCTAATGGAAGTGTTGCTTCACGT
CTGAGAGAACGACCACCATCTGAACCTCCACTTGATTGGCAAACAAGAAGAAGGATCGCA
GCAGGTTCTGCCAGGGGGCTGTCCTATTTACATGATCATTGCAACCCAAAGATCATCCAT
CGTGATGTCAAAGCGGCAAATATTTTATTAGATGAAGACTTTGAAGCTGTATTTGGAGAT
TTTGGTTTGGCCAAACCAATGGATTACAAGGATACCCATGTAACAACTGCAGTACATGGA
ACAATTGGACATATTGCACCAGAATATCTTTCAACAGGAATTCTCTCTGAGAAAACTGAT
GTATTTGGCTATGGAATCATGCTTTTGGAGCTTATTACAGGAAAACGTGCCTTTGATCTT
GCTCTTCTAGCCAGAGGTGAGGGTGTCATGCCACTGGACTGGGTCAAACGATTAATCAAG
GAGGAAAAGCTGGAGAAATTGATTGATCCAGATCTACAGAACAAGTACATTGATGCTGAG
GTAGAATCACTAATCCAGGTCGCGCTTCTTTGCACACAAGGCTCCCCTCTGGAACGCCCC
AAGATGGCTGCGGTGGTGAGGATGCTTGATGAAGGTGATGGCCTTGCTGAAAGATGGAAG
GAGTGGCAGAAGATAGAAATAGTACAGCAGGACGTGGAGCTTGGCCTGTATCAGAATGGT
TGGACTGTTGACTCAACTGAGAACCTCCATGCGGTCGAGTTATCAGGGCCAAGGTGA

Protein

399 aa

>Os08t0176200-01 Serine/threonine protein kinase-related domain containing protein.
PLFFFFFLAGRSSRTGAISGGVAAGAALLFNIPAIGFAWWRRRKPQEYFPVVPGVHLGQL
KRFSLRELQVATKTFNNKNILGTGGFSKVYKGRLADGSLVAVKRLKEQRTPGGELQFQTE
VEMISMALHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERPPSEPPLDWQTRRRIA
AGSARGLSYLHDHCNPKIIHRDVKAANILLDEDFEAVFGDFGLAKPMDYKDTHVTTAVHG
TIGHIAPEYLSTGILSEKTDVFGYGIMLLELITGKRAFDLALLARGEGVMPLDWVKRLIK
EEKLEKLIDPDLQNKYIDAEVESLIQVALLCTQGSPLERPKMAAVVRMLDEGDGLAERWK
EWQKIEIVQQDVELGLYQNGWTVDSTENLHAVELSGPR*

CDS

chr08:4445655..4445814 (+ strand) : 160 bp

chr08:4445898..4446224 (+ strand) : 327 bp

chr08:4446307..4446701 (+ strand) : 395 bp

chr08:4446895..4447209 (+ strand) : 315 bp

3'UTR

chr08:4447210..4447532 (+ strand) : 323 bp

FASTA

>Os08t0176200-01 class=Sequence position=chr08:4445655..4447532 (+ strand)
CCCCTCTTTT TTTTTTTTTT TTTGGCAGGG AGGTCATCTC GTACTGGAGC AATTTCTGGT GGAGTGGCTG CTGGAGCAGC
CTTGCTATTT AATATTCCTG CTATTGGTTT TGCCTGGTGG CGACGCAGGA AACCCCAAGA GTATTTTCCT GTTGTACCTG
GTAAGCATCC AATAGAACAG GGGACTTGGA GAACAACTTT GATTCAACTT ACATTTCCTT ATTTGTTACA ACTAAGTATA
CAGGGGTCCA TCTTGGCCAG CTTAAAAGAT TTTCGCTACG AGAACTTCAA GTTGCAACAA AGACCTTCAA CAATAAAAAC
ATTCTTGGCA CAGGCGGTTT TAGCAAGGTC TATAAAGGAA GACTAGCAGA TGGTTCTTTA GTAGCTGTTA AGAGACTAAA
GGAGCAGAGA ACACCTGGTG GGGAACTACA GTTTCAAACA GAAGTTGAGA TGATTAGCAT GGCTTTACAT AGAAATCTGT
TGCGTTTACG TGGGTTCTGT ATGACACCCA CAGAAAGGTT GCTTGTGTAT CCATACATGG CTAATGGAAG TGTTGCTTCA
CGTCTGAGAG GTACCTCGCC TTCCTTTTTT CCAGTCATGC ATCCCTATAT CTTTCAGACA ATTAGAGGTT TGATTTGGGT
CTTATTTTGT AGAACGACCA CCATCTGAAC CTCCACTTGA TTGGCAAACA AGAAGAAGGA TCGCAGCAGG TTCTGCCAGG
GGGCTGTCCT ATTTACATGA TCATTGCAAC CCAAAGATCA TCCATCGTGA TGTCAAAGCG GCAAATATTT TATTAGATGA
AGACTTTGAA GCTGTATTTG GAGATTTTGG TTTGGCCAAA CCAATGGATT ACAAGGATAC CCATGTAACA ACTGCAGTAC
ATGGAACAAT TGGACATATT GCACCAGAAT ATCTTTCAAC AGGAATTCTC TCTGAGAAAA CTGATGTATT TGGCTATGGA
ATCATGCTTT TGGAGCTTAT TACAGGAAAA CGTGCCTTTG ATCTTGCTCT TCTAGCCAGA GGTGAGGGTG TCATGCCACT
GGACTGGGTA AGTAACTGGT ACATTCCTCA ATCCAAATTG CAGTCGAGAT GTTCATGCCC TTTTGTGGCT TGCTGCTGTG
TCAGAGTTAG ATAAAGTAAC TTTTCTGTAT GTCCAAAAAT ATCATCTAAT AAAATGTAGT TTCAGACTTT CAATAAAGGT
CTTAAAAAAT AGTATTTTTA TGGTTATGTG CTCTGTGCAG GTCAAACGAT TAATCAAGGA GGAAAAGCTG GAGAAATTGA
TTGATCCAGA TCTACAGAAC AAGTACATTG ATGCTGAGGT AGAATCACTA ATCCAGGTCG CGCTTCTTTG CACACAAGGC
TCCCCTCTGG AACGCCCCAA GATGGCTGCG GTGGTGAGGA TGCTTGATGA AGGTGATGGC CTTGCTGAAA GATGGAAGGA
GTGGCAGAAG ATAGAAATAG TACAGCAGGA CGTGGAGCTT GGCCTGTATC AGAATGGTTG GACTGTTGAC TCAACTGAGA
ACCTCCATGC GGTCGAGTTA TCAGGGCCAA GGTGATGAAT GCTCACCGGT AACTTTCTGC TGATTCTTGT ACATCGGAAG
AGCAATTCGT ACTGATCACC CTAGTCGAAT CACCATCTGT TCATATTTGT TTGATGTATA ATGCTTTTTC TTGCTCGACG
CACAACCATG GACATTGCCA TATTGGTGCC ACGGAAACAG CACAACCCGA GGAACTAGTG TCCTGAGTGG TTGCTGCAAC
AATGTCCCAG TATGTTAAAC CTACAATTTA GTAGGATGGA ACTGGGTATC ATTTTTGCCT CCTTTGGGAA GGCTTCAGAT
GATGCAATTG CCCATGGTGT ACTTTTATTT GGGCATTT