Os08t0180100-01

Locus

Os08g0180100

Description

Similar to SET domain-containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET27, SDG701

Oryzabase Gene Name Synonym(s)

SET protein 27, SET DOMAIN GROUP701, SET DOMAIN GROUP 701

Transcript Evidence

AK121489 (DDBJ, Best hit)

Protein Evidence

XP_002870257.1 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

SET domain (IPR001214)

Full-length cDNA

J023150L05 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0180100-01)

Others

Oryzabase (13391)

Transcript

1977 bp

>Os08t0180100-01 Similar to SET domain-containing protein.
AGGGTCTTGGAGTTGTTTGTAACAAAACGGGTGGATTTGGTGTAGACGACTTTGTCATCG
AGTTCTTTGGGGAGGTATACCCTTCTTGGAGATGGTATGAAAAACAAGATGGCATTAAGC
ATATACAAAACAATAGCGACGATCAAGCTCCTGAGTTTTACAACATTATGCTAGAACGGC
CAAAGGGAGACCGTGATGGGTATGACTTGGTTTTCGTTGATGCAATGCATAAGGCTAACT
ATGCGAGCAGAATTTGTCACTCCTGCAACCCTAACTGTGAAGCAAAAGTAACGGCTGTGG
ATGGTCATTATCAGATTGGAATTTACACTGTTCGACCAATTGCAGAAGGCGAGGAAATCA
CTTTTGATTACAACTCTGTTACTGAGAGTAAAGAAGAGCACGAAGCGTCAGTTTGTCTCT
GTGGAAGTCAAATATGCAGGGGCAGCTATTTAAATTTTTCTGGGGAAGGAGCTTTTGAAA
AGGTCTTGATGGAATTCCATGGTGTGCTCGATCGACATAGTCTTCTGTTACAGGCTTGTG
AAGCAAACTCTGTTTCTCAACAAGACTTAATTGACTTGGGGAGAGCTGGTCTTGGTACCT
GTTTGCTTGCTGGTTTGCCTGGATGGCTTGTTGCTTACACTGCTCACCTGGTGCGGTTTA
TATTCTTTGAGAGACAGAAACTTCCTCATGAGATCTTTAAACACAATGTGGACGAGAAGC
GCCAGTTTTTCACAGATATAAACATGGATTCCGAGAAGAATGATGCCGAGGTTCAGGCCG
AGGGAGTTCTGAATTCAAGATTACAGAATTTGACTCATACACTTGACAAGGTAAGATATG
TCATGAGATGCATATTTGGGGATCCCAAGAATGCTCCTCCTCCACTGGTGAGGCTAACTG
GGAGAAGTCTAGTTTCTGCCATCTGGAAAGGGGAAGGCTCGTTAGTTGATGAACTTCTTG
AGTCAATGGAACCTCATGTTGAGGAAGATGTACTTACTGACCTCAAAGCCAAAATTCGTG
CTCATGATCCATCTGGTTCCGAGGACATTGAGGGAGAAATCCGAAGTTCTCTTTTATGGT
TGCGTGATGAGCTGAGAACTCTTTCATGCACATACAAGTGTCGGCATGATGCTGCTGCTG
ATTTGATTCACATGTATGCTTACACAAAGTGTTTTTTCAGAGTCCGAGATTACAAGACGG
TAAAATCTCCACCGGTTCTTATCAGTCCTCTTGATTTAGGTCCCAAATATGCAGATAAAC
TGGGACCAGGCTTCCAGGAGTACTGTAAGACATACCCAGAAAATTATTGCTTAGGTCAAC
TCATTTATTGGTATAGCCAGAATGCGGAGCCTGAATCTAGATTGACAAGAGCTAGAAAGG
GTTGTATGTCATTGCCAGATGTATCCTCCTTCTATGTGAAGTCAGTAAAACCAACACAAG
AGCGAGTCTATGGCAGCAGAACTGTGAGATTCATGTTAGCGCGCATGGAGAACCAGGCAC
AAAGGCCATGGCCCAAGGACCGGATATGGGTTTTCAAGAGTGACCCAAGATTCTTTGGTA
CTCCAATGATGGATGCCGTATTGAATAATTCCCCCCTTGACAAGGAGATGGTGCATTGGC
TCAAGACAAGATCCAACGTCTTCCTAGGCTAGCCAAGGAATTGTAGGCAGAGGGTATTGG
TTTTTTTCCTTTGGAGATTTTAGTCAGACACCATTCTTTTTTCTTCCTACTCACACCTTT
CCTACCTAATCATGGGGATTTAGCTTTTAGATGGCAGGGTAACAACAGTCTCTCTCACCT
TCCCCATTTGTACAGCCCCCTCCTCCCCTTACCTTGTAGAGATGTGTTCCATTATTAACT
GATAGATCCATCATTGATTTAATGTAGCGCCTTTTCCCGTTGCGTAGAATTGTCACCTCC
CAATGTGCAATGTGGATATTCATGTGTAAATGCAAAACAGTAGCAATCTTAAATTCC

CDS

1650 bp

>Os08t0180100-01 Similar to SET domain-containing protein.
GGTCTTGGAGTTGTTTGTAACAAAACGGGTGGATTTGGTGTAGACGACTTTGTCATCGAG
TTCTTTGGGGAGGTATACCCTTCTTGGAGATGGTATGAAAAACAAGATGGCATTAAGCAT
ATACAAAACAATAGCGACGATCAAGCTCCTGAGTTTTACAACATTATGCTAGAACGGCCA
AAGGGAGACCGTGATGGGTATGACTTGGTTTTCGTTGATGCAATGCATAAGGCTAACTAT
GCGAGCAGAATTTGTCACTCCTGCAACCCTAACTGTGAAGCAAAAGTAACGGCTGTGGAT
GGTCATTATCAGATTGGAATTTACACTGTTCGACCAATTGCAGAAGGCGAGGAAATCACT
TTTGATTACAACTCTGTTACTGAGAGTAAAGAAGAGCACGAAGCGTCAGTTTGTCTCTGT
GGAAGTCAAATATGCAGGGGCAGCTATTTAAATTTTTCTGGGGAAGGAGCTTTTGAAAAG
GTCTTGATGGAATTCCATGGTGTGCTCGATCGACATAGTCTTCTGTTACAGGCTTGTGAA
GCAAACTCTGTTTCTCAACAAGACTTAATTGACTTGGGGAGAGCTGGTCTTGGTACCTGT
TTGCTTGCTGGTTTGCCTGGATGGCTTGTTGCTTACACTGCTCACCTGGTGCGGTTTATA
TTCTTTGAGAGACAGAAACTTCCTCATGAGATCTTTAAACACAATGTGGACGAGAAGCGC
CAGTTTTTCACAGATATAAACATGGATTCCGAGAAGAATGATGCCGAGGTTCAGGCCGAG
GGAGTTCTGAATTCAAGATTACAGAATTTGACTCATACACTTGACAAGGTAAGATATGTC
ATGAGATGCATATTTGGGGATCCCAAGAATGCTCCTCCTCCACTGGTGAGGCTAACTGGG
AGAAGTCTAGTTTCTGCCATCTGGAAAGGGGAAGGCTCGTTAGTTGATGAACTTCTTGAG
TCAATGGAACCTCATGTTGAGGAAGATGTACTTACTGACCTCAAAGCCAAAATTCGTGCT
CATGATCCATCTGGTTCCGAGGACATTGAGGGAGAAATCCGAAGTTCTCTTTTATGGTTG
CGTGATGAGCTGAGAACTCTTTCATGCACATACAAGTGTCGGCATGATGCTGCTGCTGAT
TTGATTCACATGTATGCTTACACAAAGTGTTTTTTCAGAGTCCGAGATTACAAGACGGTA
AAATCTCCACCGGTTCTTATCAGTCCTCTTGATTTAGGTCCCAAATATGCAGATAAACTG
GGACCAGGCTTCCAGGAGTACTGTAAGACATACCCAGAAAATTATTGCTTAGGTCAACTC
ATTTATTGGTATAGCCAGAATGCGGAGCCTGAATCTAGATTGACAAGAGCTAGAAAGGGT
TGTATGTCATTGCCAGATGTATCCTCCTTCTATGTGAAGTCAGTAAAACCAACACAAGAG
CGAGTCTATGGCAGCAGAACTGTGAGATTCATGTTAGCGCGCATGGAGAACCAGGCACAA
AGGCCATGGCCCAAGGACCGGATATGGGTTTTCAAGAGTGACCCAAGATTCTTTGGTACT
CCAATGATGGATGCCGTATTGAATAATTCCCCCCTTGACAAGGAGATGGTGCATTGGCTC
AAGACAAGATCCAACGTCTTCCTAGGCTAG

Protein

550 aa

>Os08t0180100-01 Similar to SET domain-containing protein.
GLGVVCNKTGGFGVDDFVIEFFGEVYPSWRWYEKQDGIKHIQNNSDDQAPEFYNIMLERP
KGDRDGYDLVFVDAMHKANYASRICHSCNPNCEAKVTAVDGHYQIGIYTVRPIAEGEEIT
FDYNSVTESKEEHEASVCLCGSQICRGSYLNFSGEGAFEKVLMEFHGVLDRHSLLLQACE
ANSVSQQDLIDLGRAGLGTCLLAGLPGWLVAYTAHLVRFIFFERQKLPHEIFKHNVDEKR
QFFTDINMDSEKNDAEVQAEGVLNSRLQNLTHTLDKVRYVMRCIFGDPKNAPPPLVRLTG
RSLVSAIWKGEGSLVDELLESMEPHVEEDVLTDLKAKIRAHDPSGSEDIEGEIRSSLLWL
RDELRTLSCTYKCRHDAAADLIHMYAYTKCFFRVRDYKTVKSPPVLISPLDLGPKYADKL
GPGFQEYCKTYPENYCLGQLIYWYSQNAEPESRLTRARKGCMSLPDVSSFYVKSVKPTQE
RVYGSRTVRFMLARMENQAQRPWPKDRIWVFKSDPRFFGTPMMDAVLNNSPLDKEMVHWL
KTRSNVFLG*

5'UTR

chr08:4692655..4692656 (+ strand) : 2 bp

CDS

chr08:4692657..4692728 (+ strand) : 72 bp

chr08:4692821..4692931 (+ strand) : 111 bp

chr08:4693038..4693138 (+ strand) : 101 bp

chr08:4694058..4694157 (+ strand) : 100 bp

chr08:4694235..4694330 (+ strand) : 96 bp

chr08:4694450..4694617 (+ strand) : 168 bp

chr08:4694711..4694836 (+ strand) : 126 bp

chr08:4694910..4694963 (+ strand) : 54 bp

chr08:4695089..4695336 (+ strand) : 248 bp

chr08:4695431..4695539 (+ strand) : 109 bp

chr08:4695628..4695927 (+ strand) : 300 bp

chr08:4696143..4696307 (+ strand) : 165 bp

3'UTR

chr08:4696308..4696632 (+ strand) : 325 bp

FASTA

>Os08t0180100-01 class=Sequence position=chr08:4692655..4696632 (+ strand)
AGGGTCTTGG AGTTGTTTGT AACAAAACGG GTGGATTTGG TGTAGACGAC TTTGTCATCG AGTTCTTTGG GGAGGTATGT
GATTTTTACG ATCAACAAAT CTTCCTAGAT GACATGCAAA GGGATATAAC AATGGTATAA TATTTGTGAA ATTGCAATAT
CTGCAGGTAT ACCCTTCTTG GAGATGGTAT GAAAAACAAG ATGGCATTAA GCATATACAA AACAATAGCG ACGATCAAGC
TCCTGAGTTT TACAACATTA TGCTAGAACG GCCAAAGGTA TTAGTGCAAT CTCAAATTTT TTAATGTGAC CTTGCATGTG
ACTTATGTTA TTCCAGGTCA AGGTACATAT AACTGATCGT TTTACCTTTG TTATGATAAA AAGGGAGACC GTGATGGGTA
TGACTTGGTT TTCGTTGATG CAATGCATAA GGCTAACTAT GCGAGCAGAA TTTGTCACTC CTGCAACCCT AACTGTGAAG
CAAAGTAAGC TTCTTAATCT TCAGATTAGT ACCTTGTGTG GTGTATGTGT ACTGCCTTAT CACTCCTCCT ATAGTACTTC
CTCTGTTTCA AAATATAGTG TGCATTTTGT TTCGTTAGGA CAAGAGTTTG GCCAACGATT ACTCTATTAT GATATAATTT
TTACGACACA TAAATTTATT AGATTCATAT CCAGAAGTAC TTATGATTAT ACTTTTGTAT CACAAATGAT ATTCTaatag
agcgattgtt ggtcaaagtc gtcctaacga aacaaaatat gccctttgtt ttgaaacaga gggagtaCCT TTTTAGTGTT
GACCTGTACT TTTGGACTGT ATTTGTGGAA GGGGTTTACT CTGTTAACTA AATTTATATA TGTGGTGTTG CAGTTTGCAC
GTGATATATG CTTGGCCCTA TCATTTACGC AACTACCTTC TATTGTCTTT TTCATATTTT GAAAGGCCTT TGTGACTTCA
TTGTTGTTGT ATTCTGTGGT GGATCCATCC TATGCTTTGA ACTGTAGTGG GGGAATGCGA TTTCACTCTT CCTGCATGTC
TACTTCATTC TATTTGGTTC ACCATGCGCT GTTGTATTTT TTTCTGAACA AAGTCCCTGA TGGCCTGTTT TTGTTGTTCC
AGTAGTGAAA TTCAGAAATT GAGAACAAAC AGGGAAGGGG GCAGCAATCA ATGGATGGCT AACAATTTAT AAAAACTGAA
CTGCACATTT ATAGTTTAAG CATTTTCTGT ACACCTGTAC CTAATATTGA AGGACTCTTA AGATTGAAGG AGAACTGGCC
CATATTGGTT TCCACAAAGC CCACTTTCCA TGCTAGTCAA ATTTATAAAT TAGTAAAATG CACTCATAAG ATTACATGTT
ATACCTGTAA TAATAACTCA CGATTATTAA AATATATTTC CAGAGTAACG GCTGTGGATG GTCATTATCA GATTGGAATT
TACACTGTTC GACCAATTGC AGAAGGCGAG GAAATCACTT TTGATTACAA CTCTGTTACT GAGGTGATTG CCATTTCTAG
TTTCTGTATA AGTTCTAACG TAAATTGCTT TATCTTATGA ATACATTCTA ATTATGCCAG AGTAAAGAAG AGCACGAAGC
GTCAGTTTGT CTCTGTGGAA GTCAAATATG CAGGGGCAGC TATTTAAATT TTTCTGGGGA AGGAGCTTTT GAAAAGGTAA
ACTTCATTCT TGTTTACAGT AATTTAGGAA CTGACACTTG CAGTTTATCA AATTGTCATA CACTGAATTT TATACTGCAT
CATTTCCTCT CATCTACTAA TATCATTTGG AACAGGTCTT GATGGAATTC CATGGTGTGC TCGATCGACA TAGTCTTCTG
TTACAGGCTT GTGAAGCAAA CTCTGTTTCT CAACAAGACT TAATTGACTT GGGGAGAGCT GGTCTTGGTA CCTGTTTGCT
TGCTGGTTTG CCTGGATGGC TTGTTGCTTA CACTGCTCAC CTGGTAATTG TAGTTACCAT TTTCTTAAAG CTTCTTTTTT
CTTGATACAG TAATCAGTAT CGTGATCCCT CATGGCTATT TTTCCTGTAA ACAAAGGTGC GGTTTATATT CTTTGAGAGA
CAGAAACTTC CTCATGAGAT CTTTAAACAC AATGTGGACG AGAAGCGCCA GTTTTTCACA GATATAAACA TGGATTCCGA
GAAGAATGAT GCCGAGGTTC AGGTGGGTCT TCGAACGGCT ACAAGTTGCA ACGTAATTTA CATAAAATCG ATCTAATTCT
GTCATCACTA CTCAGGCCGA GGGAGTTCTG AATTCAAGAT TACAGAATTT GACTCATACA CTTGACAAGG TGCGCATTTT
ATGCCCCCTA GCTTGAAGTT ATTCAGTATA AGTGAACAAA AAACATGCAC TATGCACTAA CAACCCAAAA GAAGTCTCTT
CTGATGCATT TTTATGGATC ATTGTTATGT TCAGGTAAGA TATGTCATGA GATGCATATT TGGGGATCCC AAGAATGCTC
CTCCTCCACT GGTGAGGCTA ACTGGGAGAA GTCTAGTTTC TGCCATCTGG AAAGGGGAAG GCTCGTTAGT TGATGAACTT
CTTGAGTCAA TGGAACCTCA TGTTGAGGAA GATGTACTTA CTGACCTCAA AGCCAAAATT CGTGCTCATG ATCCATCTGG
TTCCGAGGAC ATTGAGGGAG AAATCCGAAG TTCTCTTTTA TGGTGAGTTT AGAATATATT CTTGTTTTGT TTGACCATTA
ATCTGACTCT TCCCTCCAGT CACCTGTATC TGGAATCTGA CCGCCCTTTT CTTCAGGTTG CGTGATGAGC TGAGAACTCT
TTCATGCACA TACAAGTGTC GGCATGATGC TGCTGCTGAT TTGATTCACA TGTATGCTTA CACAAAGTGT TTTTTCAGAG
TCCGAGTAAG TGAAAACTTC CTCTTAATTT TGCAACAAAT GTTTGTGATT TTTCTCTGTA CCAAAGGACT GACTCAAGGA
TCACCACATG CAGGATTACA AGACGGTAAA ATCTCCACCG GTTCTTATCA GTCCTCTTGA TTTAGGTCCC AAATATGCAG
ATAAACTGGG ACCAGGCTTC CAGGAGTACT GTAAGACATA CCCAGAAAAT TATTGCTTAG GTCAACTCAT TTATTGGTAT
AGCCAGAATG CGGAGCCTGA ATCTAGATTG ACAAGAGCTA GAAAGGGTTG TATGTCATTG CCAGATGTAT CCTCCTTCTA
TGTGAAGTCA GTAAAACCAA CACAAGAGCG AGTCTATGGC AGCAGAACTG TGAGATTCAT GTTAGCGCGC ATGGTAAGTG
CTTACCTTTT ATATGTCATT GTGGCTAAAA TATTCCAAAT TTTGTTCTTG GAACTCGTTC AGTGTGGAAA ACAAAAGAGA
ATATTTGTTC TAGACAATAT TAAATCATCT TCTGTTGGAT TGAGTATTTC TCTTCATATA TGCAATATAT TACAGTTTCT
TTCCCTGACT CCCATCTTTC TCAATGAAAC TGCGTGGTTT TATTACAGGA GAACCAGGCA CAAAGGCCAT GGCCCAAGGA
CCGGATATGG GTTTTCAAGA GTGACCCAAG ATTCTTTGGT ACTCCAATGA TGGATGCCGT ATTGAATAAT TCCCCCCTTG
ACAAGGAGAT GGTGCATTGG CTCAAGACAA GATCCAACGT CTTCCTAGGC TAGCCAAGGA ATTGTAGGCA GAGGGTATTG
GTTTTTTTCC TTTGGAGATT TTAGTCAGAC ACCATTCTTT TTTCTTCCTA CTCACACCTT TCCTACCTAA TCATGGGGAT
TTAGCTTTTA GATGGCAGGG TAACAACAGT CTCTCTCACC TTCCCCATTT GTACAGCCCC CTCCTCCCCT TACCTTGTAG
AGATGTGTTC CATTATTAAC TGATAGATCC ATCATTGATT TAATGTAGCG CCTTTTCCCG TTGCGTAGAA TTGTCACCTC
CCAATGTGCA ATGTGGATAT TCATGTGTAA ATGCAAAACA GTAGCAATCT TAAATTCC

Locus: Os08g0180100

Loading...

Locus: Os08g0180100

Loading...