Os08t0180100-02

Locus

Os08g0180100

Description

Similar to SET domain protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET27, SDG701

Oryzabase Gene Name Synonym(s)

SET protein 27, SET DOMAIN GROUP701, SET DOMAIN GROUP 701

Transcript Evidence

AK058948 (DDBJ, Best hit)

Protein Evidence

XP_002870257.1 (RefSeq)

Literature

Note

Manual Curation

Full-length cDNA

001-020-A05 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0180100-02)

RiceXPro (AK058948)

Others

Oryzabase (13391)

KEGG (Os08t0180100-02)

Transcript

1100 bp

>Os08t0180100-02 Similar to SET domain protein.
ATTTGACTCATACACTTGACAAGGTAAGATATGTCATGAGATGCATATTTGGGGATCCCA
AGAATGCTCCTCCTCCACTGGTGAGGCTAACTGGGAGAAGTCTAGTTTCTGCCATCTGGA
AAGGGGAAGGCTCGTTAGTTGATGAACTTCTTGAGTCAATGGAACCTCATGTTGAGGAAG
ATGTACTTACTGACCTCAAAGCCAAAATTCGTGCTCATGATCCATCTGGTTCCGAGGACA
TTGAGGGAGAAATCCGAAGTTCTCTTTTATGGTTGCGTGATGAGCTGAGAACTCTTTCAT
GCACATACAAGTGTCGGCATGATGCTGCTGCTGATTTGATTCACATGTATGCTTACACAA
AGTGTTTTTTCAGAGTCCGAGATTACAAGACGGTAAAATCTCCACCGGTTCTTATCAGTC
CTCTTGATTTAGGTCCCAAATATGCAGATAAACTGGGACCAGGCTTCCAGGAGTACTGTA
AGACATACCCAGAAAATTATTGCTTAGGTCAACTCATTTATTGGTATAGCCAGAATGCGG
AGCCTGAATCTAGATTGACAAGAGCTAGAAAGGGTTGTATGTCATTGCCAGATGTATCCT
CCTTCTATGTGAAGTCAGTAAAACCAACACAAGAGCGAGTCTATGGCAGCAGAACTGTGA
GATTCATGTTAGCGCGCATGGAGAACCAGGCACAAAGGCCATGGCCCAAGGACCGGATAT
GGGTTTTCAAGAGTGACCCAAGATTCTTTGGTACTCCAATGATGGATGCCGTATTGAATA
ATTCCCCCCTTGACAAGGAGATGGTGCATTGGCTCAAGACAAGATCCAACGTCTTCCTAG
GCTAGCCAAGGAATTGTAGGCAGAGGGTATTGGTTTTTTTCCTTTGGAGATTTTAGTCAG
ACACCATTCTTTTTTCTTCCTACTCACACCTTTCCTACCTAATCATGGGGATTTAGCTTT
TAGATGGCAGGGTAACAACAGTCTCTCTCACCTTCCCCATTTGTACAGCCCCCTCCTCCC
CTTACCTTGTAGAGATGTGTTCCATTATTAACTGATAGATCCATCATTGATTTAATGTAG
CGCCTTTTCCCGTTGCGTAG

CDS

843 bp

>Os08t0180100-02 Similar to SET domain protein.
TTGACTCATACACTTGACAAGGTAAGATATGTCATGAGATGCATATTTGGGGATCCCAAG
AATGCTCCTCCTCCACTGGTGAGGCTAACTGGGAGAAGTCTAGTTTCTGCCATCTGGAAA
GGGGAAGGCTCGTTAGTTGATGAACTTCTTGAGTCAATGGAACCTCATGTTGAGGAAGAT
GTACTTACTGACCTCAAAGCCAAAATTCGTGCTCATGATCCATCTGGTTCCGAGGACATT
GAGGGAGAAATCCGAAGTTCTCTTTTATGGTTGCGTGATGAGCTGAGAACTCTTTCATGC
ACATACAAGTGTCGGCATGATGCTGCTGCTGATTTGATTCACATGTATGCTTACACAAAG
TGTTTTTTCAGAGTCCGAGATTACAAGACGGTAAAATCTCCACCGGTTCTTATCAGTCCT
CTTGATTTAGGTCCCAAATATGCAGATAAACTGGGACCAGGCTTCCAGGAGTACTGTAAG
ACATACCCAGAAAATTATTGCTTAGGTCAACTCATTTATTGGTATAGCCAGAATGCGGAG
CCTGAATCTAGATTGACAAGAGCTAGAAAGGGTTGTATGTCATTGCCAGATGTATCCTCC
TTCTATGTGAAGTCAGTAAAACCAACACAAGAGCGAGTCTATGGCAGCAGAACTGTGAGA
TTCATGTTAGCGCGCATGGAGAACCAGGCACAAAGGCCATGGCCCAAGGACCGGATATGG
GTTTTCAAGAGTGACCCAAGATTCTTTGGTACTCCAATGATGGATGCCGTATTGAATAAT
TCCCCCCTTGACAAGGAGATGGTGCATTGGCTCAAGACAAGATCCAACGTCTTCCTAGGC
TAG

Protein

281 aa

>Os08t0180100-02 Similar to SET domain protein.
LTHTLDKVRYVMRCIFGDPKNAPPPLVRLTGRSLVSAIWKGEGSLVDELLESMEPHVEED
VLTDLKAKIRAHDPSGSEDIEGEIRSSLLWLRDELRTLSCTYKCRHDAAADLIHMYAYTK
CFFRVRDYKTVKSPPVLISPLDLGPKYADKLGPGFQEYCKTYPENYCLGQLIYWYSQNAE
PESRLTRARKGCMSLPDVSSFYVKSVKPTQERVYGSRTVRFMLARMENQAQRPWPKDRIW
VFKSDPRFFGTPMMDAVLNNSPLDKEMVHWLKTRSNVFLG*

5'UTR

chr08:4694941..4694942 (+ strand) : 2 bp

CDS

chr08:4694943..4694963 (+ strand) : 21 bp

chr08:4695089..4695336 (+ strand) : 248 bp

chr08:4695431..4695539 (+ strand) : 109 bp

chr08:4695628..4695927 (+ strand) : 300 bp

chr08:4696143..4696307 (+ strand) : 165 bp

3'UTR

chr08:4696308..4696562 (+ strand) : 255 bp

FASTA

>Os08t0180100-02 class=Sequence position=chr08:4694941..4696562 (+ strand)
ATTTGACTCA TACACTTGAC AAGGTGCGCA TTTTATGCCC CCTAGCTTGA AGTTATTCAG TATAAGTGAA CAAAAAACAT
GCACTATGCA CTAACAACCC AAAAGAAGTC TCTTCTGATG CATTTTTATG GATCATTGTT ATGTTCAGGT AAGATATGTC
ATGAGATGCA TATTTGGGGA TCCCAAGAAT GCTCCTCCTC CACTGGTGAG GCTAACTGGG AGAAGTCTAG TTTCTGCCAT
CTGGAAAGGG GAAGGCTCGT TAGTTGATGA ACTTCTTGAG TCAATGGAAC CTCATGTTGA GGAAGATGTA CTTACTGACC
TCAAAGCCAA AATTCGTGCT CATGATCCAT CTGGTTCCGA GGACATTGAG GGAGAAATCC GAAGTTCTCT TTTATGGTGA
GTTTAGAATA TATTCTTGTT TTGTTTGACC ATTAATCTGA CTCTTCCCTC CAGTCACCTG TATCTGGAAT CTGACCGCCC
TTTTCTTCAG GTTGCGTGAT GAGCTGAGAA CTCTTTCATG CACATACAAG TGTCGGCATG ATGCTGCTGC TGATTTGATT
CACATGTATG CTTACACAAA GTGTTTTTTC AGAGTCCGAG TAAGTGAAAA CTTCCTCTTA ATTTTGCAAC AAATGTTTGT
GATTTTTCTC TGTACCAAAG GACTGACTCA AGGATCACCA CATGCAGGAT TACAAGACGG TAAAATCTCC ACCGGTTCTT
ATCAGTCCTC TTGATTTAGG TCCCAAATAT GCAGATAAAC TGGGACCAGG CTTCCAGGAG TACTGTAAGA CATACCCAGA
AAATTATTGC TTAGGTCAAC TCATTTATTG GTATAGCCAG AATGCGGAGC CTGAATCTAG ATTGACAAGA GCTAGAAAGG
GTTGTATGTC ATTGCCAGAT GTATCCTCCT TCTATGTGAA GTCAGTAAAA CCAACACAAG AGCGAGTCTA TGGCAGCAGA
ACTGTGAGAT TCATGTTAGC GCGCATGGTA AGTGCTTACC TTTTATATGT CATTGTGGCT AAAATATTCC AAATTTTGTT
CTTGGAACTC GTTCAGTGTG GAAAACAAAA GAGAATATTT GTTCTAGACA ATATTAAATC ATCTTCTGTT GGATTGAGTA
TTTCTCTTCA TATATGCAAT ATATTACAGT TTCTTTCCCT GACTCCCATC TTTCTCAATG AAACTGCGTG GTTTTATTAC
AGGAGAACCA GGCACAAAGG CCATGGCCCA AGGACCGGAT ATGGGTTTTC AAGAGTGACC CAAGATTCTT TGGTACTCCA
ATGATGGATG CCGTATTGAA TAATTCCCCC CTTGACAAGG AGATGGTGCA TTGGCTCAAG ACAAGATCCA ACGTCTTCCT
AGGCTAGCCA AGGAATTGTA GGCAGAGGGT ATTGGTTTTT TTCCTTTGGA GATTTTAGTC AGACACCATT CTTTTTTCTT
CCTACTCACA CCTTTCCTAC CTAATCATGG GGATTTAGCT TTTAGATGGC AGGGTAACAA CAGTCTCTCT CACCTTCCCC
ATTTGTACAG CCCCCTCCTC CCCTTACCTT GTAGAGATGT GTTCCATTAT TAACTGATAG ATCCATCATT GATTTAATGT
AGCGCCTTTT CCCGTTGCGT AG

Locus: Os08g0180100

Loading...

Locus: Os08g0180100

Loading...