Os08t0189300-01

Locus

Os08g0189300

Description

Germin-like protein 8-4, Disease resistance

RAP-DB Gene Symbol Synonym(s)

GLP8-4, OsGLP8-4, GER1

RAP-DB Gene Name Synonym(s)

GERMIN-LIKE PROTEIN 8-4, Germin-like protein 8-4, germin-like protein 1

CGSNL Gene Symbol

GLP8-4

CGSNL Gene Name

GERMIN-LIKE PROTEIN 8-4

Oryzabase Gene Symbol Synonym(s)

OsGLP8-4, GER1. OsGer1

Oryzabase Gene Name Synonym(s)

Germin-like protein 8-4, germin-like protein 1

Transcript Evidence

AF032971 (Genbank)

AK059338 (Genbank)

Protein Evidence

Q6YZZ6 (UniProt)

Literature

PMID: 19011003

PMID: 11264412

Note

Manual Curation

May 29, 2009

Gene Ontology (GO)

Cellular Component: apoplast (GO:0048046)

Molecular Function: manganese ion binding (GO:0030145)

Molecular Function: nutrient reservoir activity (GO:0045735)

Functional domain (InterPro)

Germin (IPR001929)

Cupin 1 (IPR006045)

Cupin, RmlC-type (IPR011051)

RmlC-like jelly roll fold (IPR014710)

Germin, manganese binding site (IPR019780)

Full-length cDNA

001-026-B02 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0189300-01)

RiceXPro (AK059338)

Others

Oryzabase (10288)

KEGG (Os08t0189300-01)

Transcript

893 bp

>Os08t0189300-01 Germin-like protein 8-4, Disease resistance
ATCTCACACACAGCAGGAGAAACCAACTCATAGTAGCTTAGCTAATTAACACGATGGCCT
CCTCTTCTTCCTTGTATCTCCTAGCTGCTCTGCTTGCGCTGGCCTCATGGCAGGCCATTG
CTTTTGATCCTAGCCCACTCCAAGATTTTTGTGTTGCTGACATGAAATCACCTGTGAGGG
TAAATGGATTCCCTTGCAAGAACCCAATGGAGGTGAACTCGGACGACTTTTTCAACGCGG
CCAAGTTTGACATGCCTAGGAGTACCATGAACAAGGTTGGATCCAACGTCACCAACCTCA
ACGTTCTAAATTTCCCGGGGCTCAACACCCTCGGCATCTCGCTGGCCCGCATCGACTATG
CGCCTTTAGGTGTGAACCCACCACACATTCACCCACGTGCTACCGAGCTCCTCACTGTGC
TTGAGGGAACACTCTATGTTGGCTTTGTCACGTCTAACCCAAACAGGCTCTTCTCTAAGG
TGGTTCATAAGGGTGACACATTTGTGTTTCCTAAGGCAATGATCCACTTCCAAATGAATT
TAGACCACAATAAACCAGCAGTTGCCCAGTCATCACTCAACAGTCAAAACCCTGGAGTTA
TTACAATTGCTAGTGCGGTGTTTGGATCAAAGCCACCAATCTCTGATGATGTTCTGACCA
AGGCATTTCAAGTGGAAAAGAAGGTGATTGATTGGCTCAAATCTCAGTTCTGGGAGAGCA
ACTACTGATTATCTCATACTGATTCTCCCTAATCAATTGATGCAAGTATGATATATATGA
AACCTGTACTTCATTGTAGTATGTAGAATAAATGGGCTTTTGTCCTATCAAAAATGTCAT
AATATGTTGTACGTGTGCTTTCTTGCTCATGTTTAATAAATGTTATACAATGG

CDS

675 bp

>Os08t0189300-01 Germin-like protein 8-4, Disease resistance
ATGGCCTCCTCTTCTTCCTTGTATCTCCTAGCTGCTCTGCTTGCGCTGGCCTCATGGCAG
GCCATTGCTTTTGATCCTAGCCCACTCCAAGATTTTTGTGTTGCTGACATGAAATCACCT
GTGAGGGTAAATGGATTCCCTTGCAAGAACCCAATGGAGGTGAACTCGGACGACTTTTTC
AACGCGGCCAAGTTTGACATGCCTAGGAGTACCATGAACAAGGTTGGATCCAACGTCACC
AACCTCAACGTTCTAAATTTCCCGGGGCTCAACACCCTCGGCATCTCGCTGGCCCGCATC
GACTATGCGCCTTTAGGTGTGAACCCACCACACATTCACCCACGTGCTACCGAGCTCCTC
ACTGTGCTTGAGGGAACACTCTATGTTGGCTTTGTCACGTCTAACCCAAACAGGCTCTTC
TCTAAGGTGGTTCATAAGGGTGACACATTTGTGTTTCCTAAGGCAATGATCCACTTCCAA
ATGAATTTAGACCACAATAAACCAGCAGTTGCCCAGTCATCACTCAACAGTCAAAACCCT
GGAGTTATTACAATTGCTAGTGCGGTGTTTGGATCAAAGCCACCAATCTCTGATGATGTT
CTGACCAAGGCATTTCAAGTGGAAAAGAAGGTGATTGATTGGCTCAAATCTCAGTTCTGG
GAGAGCAACTACTGA

Protein

225 aa

>Os08t0189300-01 Germin-like protein 8-4, Disease resistance
MASSSSLYLLAALLALASWQAIAFDPSPLQDFCVADMKSPVRVNGFPCKNPMEVNSDDFF
NAAKFDMPRSTMNKVGSNVTNLNVLNFPGLNTLGISLARIDYAPLGVNPPHIHPRATELL
TVLEGTLYVGFVTSNPNRLFSKVVHKGDTFVFPKAMIHFQMNLDHNKPAVAQSSLNSQNP
GVITIASAVFGSKPPISDDVLTKAFQVEKKVIDWLKSQFWESNY*

5'UTR

chr08:5228827..5228879 (+ strand) : 53 bp

CDS

chr08:5228880..5229000 (+ strand) : 121 bp

chr08:5229231..5229784 (+ strand) : 554 bp

3'UTR

chr08:5229785..5229949 (+ strand) : 165 bp

FASTA

>Os08t0189300-01 class=Sequence position=chr08:5228827..5229949 (+ strand)
ATCTCACACA CAGCAGGAGA AACCAACTCA TAGTAGCTTA GCTAATTAAC ACGATGGCCT CCTCTTCTTC CTTGTATCTC
CTAGCTGCTC TGCTTGCGCT GGCCTCATGG CAGGCCATTG CTTTTGATCC TAGCCCACTC CAAGATTTTT GTGTTGCTGA
CATGAAATCA CCTGGTAATT AAGTATATAT ATATATGTGT GTGTGTAAGT GTGTGATCAC TTGATTTAAA TAGGGTGTTA
ATTCTAATGT TGTGAAGAAA TTCACTGTTC TCATCTGAAA TTGTGCATGC GTCATGGCAC TAAAAGAATT TGTACTACTT
CTGATTTTGA AAAGTATATA TAACATTTAT ATTTACATTC TATGGAGCTT AGTATACATG TACTAACTTG TTCTATGTGA
GCAGTGAGGG TAAATGGATT CCCTTGCAAG AACCCAATGG AGGTGAACTC GGACGACTTT TTCAACGCGG CCAAGTTTGA
CATGCCTAGG AGTACCATGA ACAAGGTTGG ATCCAACGTC ACCAACCTCA ACGTTCTAAA TTTCCCGGGG CTCAACACCC
TCGGCATCTC GCTGGCCCGC ATCGACTATG CGCCTTTAGG TGTGAACCCA CCACACATTC ACCCACGTGC TACCGAGCTC
CTCACTGTGC TTGAGGGAAC ACTCTATGTT GGCTTTGTCA CGTCTAACCC AAACAGGCTC TTCTCTAAGG TGGTTCATAA
GGGTGACACA TTTGTGTTTC CTAAGGCAAT GATCCACTTC CAAATGAATT TAGACCACAA TAAACCAGCA GTTGCCCAGT
CATCACTCAA CAGTCAAAAC CCTGGAGTTA TTACAATTGC TAGTGCGGTG TTTGGATCAA AGCCACCAAT CTCTGATGAT
GTTCTGACCA AGGCATTTCA AGTGGAAAAG AAGGTGATTG ATTGGCTCAA ATCTCAGTTC TGGGAGAGCA ACTACTGATT
ATCTCATACT GATTCTCCCT AATCAATTGA TGCAAGTATG ATATATATGA AACCTGTACT TCATTGTAGT ATGTAGAATA
AATGGGCTTT TGTCCTATCA AAAATGTCAT AATATGTTGT ACGTGTGCTT TCTTGCTCAT GTTTAATAAA TGTTATACAA
TGG

Locus: Os08g0189300

Loading...

Locus: Os08g0189300

Loading...