Os08t0189900-01

Locus

Os08g0189900

Description

Germin-like protein 8-10, Disease resistance

RAP-DB Gene Symbol Synonym(s)

GLP8-10, OsGLP8-10

RAP-DB Gene Name Synonym(s)

GERMIN-LIKE PROTEIN 8-10, Germin-like protein 8-10

CGSNL Gene Symbol

GLP8-10

CGSNL Gene Name

GERMIN-LIKE PROTEIN 8-10

Oryzabase Gene Symbol Synonym(s)

OsGLP8-10, OsRGLP2, RGLP2

Oryzabase Gene Name Synonym(s)

Germin-like protein 8-10

Transcript Evidence

AF141879 (Genbank)

Protein Evidence

Q6YZ97 (UniProt)

Literature

PMID: 19011003

Note

Manual Curation

May 29, 2009

Gene Ontology (GO)

Cellular Component: apoplast (GO:0048046)

Molecular Function: manganese ion binding (GO:0030145)

Molecular Function: nutrient reservoir activity (GO:0045735)

Functional domain (InterPro)

Germin (IPR001929)

Cupin 1 (IPR006045)

Cupin, RmlC-type (IPR011051)

Germin, manganese binding site (IPR019780)

Expression Databases

TENOR (Os08t0189900-00)

RiceXPro (AF141879)

Others

Oryzabase (10289)

KEGG (Os08t0189900-00)

Transcript

867 bp

>Os08t0189900-01 Germin-like protein 8-10, Disease resistance
AGAGCAGAAAACCAAAGCCAAGTAAATGGCTTCACCATCCATCTGCCTCCTCGCTGCTCT
TCTTGCGTTGGTCTCATGGCAGGCCATCGCCTCTGATCCTAGCCCTCTGCAGGATTTCTG
CGTTGCCGATATGCACTCACCTGTACTTGTCAATGGATTCGCTTGCTTGGACCCGAAGTA
CGTCAACGCAGACCACTTCTTCAAGGCAGCCATGCTCGACACTCCTAGGAAGACAAACAA
GGTTGGATCCAACGTCACACTAATCAACGTCATGCAGATCCCTGGCCTCAACACGCTCGG
CATCTCAATTGCGCGCATCGACTACGCACCATTGGGTGAGAACCCACCGCACACGCACCC
CCGTGCCACCGAGATCCTTACTGTCCTCGAGGGAACCCTCTACGTCGGCTTCGTCACGTC
TAACCCAAACAACACATTGTTCTCCAAGGTGCTCAACAAGGGTGATGTGTTCGTGTTCCC
CGAGGGGCTCATCCACTTCCAATTCAACCCTAACCCTCATCAACCCGCAGTTGCAATTGC
TGCACTAAGCAGCCAAAACCCTGGTGCCATCACTATTGCAAATGCAGTGTTCGGATCAAA
GCCACCGATTTCAGACATAGTTTTGGCAAAGGCATTCCAAGTTGAAAAGGGCACCATTGA
TTGGCTCCAGGCTCAGTTCTGGGAGAACAACCACTATTAATTGCCTTAAAAAAATTATGC
TTACAGAATCTATGTTGTAATTTCATATATAGCATAAATAAGTGGTATGTATTTTGTATT
TCTTATCCGTTCTTCCAAGGTGTTTGTTCTTTACATTTATGTACTAATGTAAGGCCAATA
TAATACATGTATGGTTTCCCGTCGAAT

CDS

675 bp

>Os08t0189900-01 Germin-like protein 8-10, Disease resistance
ATGGCTTCACCATCCATCTGCCTCCTCGCTGCTCTTCTTGCGTTGGTCTCATGGCAGGCC
ATCGCCTCTGATCCTAGCCCTCTGCAGGATTTCTGCGTTGCCGATATGCACTCACCTGTA
CTTGTCAATGGATTCGCTTGCTTGGACCCGAAGTACGTCAACGCAGACCACTTCTTCAAG
GCAGCCATGCTCGACACTCCTAGGAAGACAAACAAGGTTGGATCCAACGTCACACTAATC
AACGTCATGCAGATCCCTGGCCTCAACACGCTCGGCATCTCAATTGCGCGCATCGACTAC
GCACCATTGGGTGAGAACCCACCGCACACGCACCCCCGTGCCACCGAGATCCTTACTGTC
CTCGAGGGAACCCTCTACGTCGGCTTCGTCACGTCTAACCCAAACAACACATTGTTCTCC
AAGGTGCTCAACAAGGGTGATGTGTTCGTGTTCCCCGAGGGGCTCATCCACTTCCAATTC
AACCCTAACCCTCATCAACCCGCAGTTGCAATTGCTGCACTAAGCAGCCAAAACCCTGGT
GCCATCACTATTGCAAATGCAGTGTTCGGATCAAAGCCACCGATTTCAGACATAGTTTTG
GCAAAGGCATTCCAAGTTGAAAAGGGCACCATTGATTGGCTCCAGGCTCAGTTCTGGGAG
AACAACCACTATTAA

Protein

225 aa

>Os08t0189900-01 Germin-like protein 8-10, Disease resistance
MASPSICLLAALLALVSWQAIASDPSPLQDFCVADMHSPVLVNGFACLDPKYVNADHFFK
AAMLDTPRKTNKVGSNVTLINVMQIPGLNTLGISIARIDYAPLGENPPHTHPRATEILTV
LEGTLYVGFVTSNPNNTLFSKVLNKGDVFVFPEGLIHFQFNPNPHQPAVAIAALSSQNPG
AITIANAVFGSKPPISDIVLAKAFQVEKGTIDWLQAQFWENNHY*

5'UTR

chr08:5260239..5260263 (+ strand) : 25 bp

CDS

chr08:5260264..5260381 (+ strand) : 118 bp

chr08:5260573..5261129 (+ strand) : 557 bp

3'UTR

chr08:5261130..5261296 (+ strand) : 167 bp

FASTA

>Os08t0189900-01 class=Sequence position=chr08:5260239..5261296 (+ strand)
AGAGCAGAAA ACCAAAGCCA AGTAAATGGC TTCACCATCC ATCTGCCTCC TCGCTGCTCT TCTTGCGTTG GTCTCATGGC
AGGCCATCGC CTCTGATCCT AGCCCTCTGC AGGATTTCTG CGTTGCCGAT ATGCACTCAC CTGGTATACC ATTTATGCTC
TTAATTTTAG ACATTTTTTA GCTTTATATA TATAATCTAA AATAATTGGA CTTTCACACA TAAATACTTG TGAGATTATT
CTACTTTACT AACATCTAGT AATTGAAACA TGTATGGATA TGTTAAAAAA GTACATAAAC CTTGAGTTTA CGAGTTAACT
TTTATATGAT ACAGTACTTG TCAATGGATT CGCTTGCTTG GACCCGAAGT ACGTCAACGC AGACCACTTC TTCAAGGCAG
CCATGCTCGA CACTCCTAGG AAGACAAACA AGGTTGGATC CAACGTCACA CTAATCAACG TCATGCAGAT CCCTGGCCTC
AACACGCTCG GCATCTCAAT TGCGCGCATC GACTACGCAC CATTGGGTGA GAACCCACCG CACACGCACC CCCGTGCCAC
CGAGATCCTT ACTGTCCTCG AGGGAACCCT CTACGTCGGC TTCGTCACGT CTAACCCAAA CAACACATTG TTCTCCAAGG
TGCTCAACAA GGGTGATGTG TTCGTGTTCC CCGAGGGGCT CATCCACTTC CAATTCAACC CTAACCCTCA TCAACCCGCA
GTTGCAATTG CTGCACTAAG CAGCCAAAAC CCTGGTGCCA TCACTATTGC AAATGCAGTG TTCGGATCAA AGCCACCGAT
TTCAGACATA GTTTTGGCAA AGGCATTCCA AGTTGAAAAG GGCACCATTG ATTGGCTCCA GGCTCAGTTC TGGGAGAACA
ACCACTATTA ATTGCCTTAA AAAAATTATG CTTACAGAAT CTATGTTGTA ATTTCATATA TAGCATAAAT AAGTGGTATG
TATTTTGTAT TTCTTATCCG TTCTTCCAAG GTGTTTGTTC TTTACATTTA TGTACTAATG TAAGGCCAAT ATAATACATG
TATGGTTTCC CGTCGAAT

Locus: Os08g0189900

Loading...

Locus: Os08g0189900

Loading...