Os08t0191000-01

Locus

Os08g0191000

Description

Auxin efflux carrier domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPILS2, PILS2

Oryzabase Gene Name Synonym(s)

PIN likes 2

Transcript Evidence

AK065037 (DDBJ, Best hit)

Protein Evidence

B6T254 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral to membrane (GO:0016021)

Functional domain (InterPro)

Auxin efflux carrier (IPR004776)

Full-length cDNA

J013001H10 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0191000-01)

RiceXPro (AK065037)

Others

Oryzabase (19846)

KEGG (Os08t0191000-01)

Transcript

2008 bp

>Os08t0191000-01 Auxin efflux carrier domain containing protein.
ACTCTTGCTTGCCTCTCTGCGTGATCCCGATCTGCAGAGCTCGCCGCCGGCGAGCTAAGC
CCCGGAGGCGCGCGCGTGGACGCCCCCCCCCCCCTTCTCCTCCGAGCAGCGGCCACCGGT
GGCCGCCGCCGCCATCTCGGTCTCGAATCGAGGTGGACAGAAAAAAGTCATCAGCTTTCT
GCATGCGATTTGGTAGATACTGACACGTCTTGATTCTGCTCAAGGAAGGCAGCTGATTGA
TTGGTTGGGAGGGCAAACTAAAAGGGGTGTAATCTTGGCCAATTCGATAGAAAAACACAG
AGATTTAGTGGCGAGAATGGATTGGCTGTCCGCGAACCTGCAGGTGAACCCTCAGGTGAC
TGTCCATGGGGACTGGGTGTCAGCAGTCATGCCGCTGATGAAGCTGCTGTGCTTGACGGT
CATCGGCCTTGTGCTGTCCAACCCGAGGACGCAGATCATCCCCAAGGCCACCTTCAAGCT
CCTGAGCAAGCTCGTCTTTGCGCTGTTCCTGCCATGCCTGATCTTTGTCCACCTTGGCCA
GTCGGTCACAATTCAGAACATCCTCGACTGGTGGTTCATCCCGGTCAACGTGCTCATCAG
CACGGCCATCGGGTGCATTCTTGGGTACATCGTCGCGCTGATCTGTCGCCCGCCGCCGCA
GTTTTTCAGGTTCACGGTGATCATGACCGGATTTGGCAACACGGGTAACCTCCCAATCGC
GATCATCGGGTCGGTTTGCCATACCACGGATCACCCCTTTGGTCCTGGATGCCACCGCAA
GGGTGTCGCTTATGTTTCGTTTGCTCAATGGGTCGCTGTTATTCTTGTCTACACCTTGGT
TTACCATATGATGGAGCCACCGATGCAATTCTACGAGATTGTAGGCGAAGGGAACGAGAT
TGTGGAAGAGCCTGCACAGATCAGCAACTACAGTAGATCTCTGCTTCATGAAGCGGAATG
GCCAGGGATGGCTGACAAAGAAACGGAGCACTCAAAGACGCCATTCATTGCACGGGTTTT
CATGAGTATTTCAGGCTCTTCACAGAATACATTTCCTGATATTGATTTTGCAGAAGAGGG
CACTTCTGGTGCTGGACCTAGCAGTCCAAAATCGCTAAGGTGTTTGGCGGAGCCAAAGGT
TGTAAGGAGGATCAGGGTTGTAGCTGAGAAGACTCCAATTCAGCATGTTCTCCAGCCACC
AACCATCGCCTCCTTGCTCGCCATTGTCATCGGCATGGTTCCTTTGTTCAAAGATTTTGT
GTTTGTGCCTGATGCACCACTGTCGTTCTTTACAGACAGTTTGGAGATTCTAGCTCAAGC
CGTTGTACCCTCGGTGATGTTAATTCTAGGGGGCATGCTTGCAGAAGGACCCAAGGATAA
TGCCTTGGGTATCCGGACTATCACTGGTATAATTGTTGCAAGGCTCCTGATTCTCCCGTG
CATTGGCATCGGTGTCGTCCTGCTGGCAGATCGGTTGCATCTGCTTGTCGAGGAAGACCA
CATGTACCGCTTTGTGCTGTCGCTACAGTACTCCACCCCTAGTGCCATCCTGCTTGGAGC
GATTGCGAGCCTCAGAGGTTATGCTGTCAAGGAAGCATCGGCACTTCTATTCTGGCAGCA
CATTTGTGCGGTGCTATCTCTCTCCATCTACCTGATCGTATATTTCAGGTTGCTTACCAT
TTGAAAGATGATGGCCGGCCGCCTTCCAAAATTGGTTTGTAGCATTCATCCTCGGAAGTG
ATTTCTAGGGAGATGGGTACTTGAATGGATTTTCAACCACGTCTCCTTATGGTCAAGTGT
ATTTATAGTATATTTAATTTTTTTTTAGCGATTTATATTTCAGATACATGTAGAACTTGA
GAACATGAGATATGTTCTTGTCGTTCATTAGTGTCAATATATTGCTGTTCGCTTGCACAT
TTCTTGATCCGATTACAGCATTACAGTTGCTGCTCAAAAGTTGTACAAGTACTGCTACAT
TAGAAGTCAATATATTGCTGTTTGATGC

CDS

1368 bp

>Os08t0191000-01 Auxin efflux carrier domain containing protein.
ATGGATTGGCTGTCCGCGAACCTGCAGGTGAACCCTCAGGTGACTGTCCATGGGGACTGG
GTGTCAGCAGTCATGCCGCTGATGAAGCTGCTGTGCTTGACGGTCATCGGCCTTGTGCTG
TCCAACCCGAGGACGCAGATCATCCCCAAGGCCACCTTCAAGCTCCTGAGCAAGCTCGTC
TTTGCGCTGTTCCTGCCATGCCTGATCTTTGTCCACCTTGGCCAGTCGGTCACAATTCAG
AACATCCTCGACTGGTGGTTCATCCCGGTCAACGTGCTCATCAGCACGGCCATCGGGTGC
ATTCTTGGGTACATCGTCGCGCTGATCTGTCGCCCGCCGCCGCAGTTTTTCAGGTTCACG
GTGATCATGACCGGATTTGGCAACACGGGTAACCTCCCAATCGCGATCATCGGGTCGGTT
TGCCATACCACGGATCACCCCTTTGGTCCTGGATGCCACCGCAAGGGTGTCGCTTATGTT
TCGTTTGCTCAATGGGTCGCTGTTATTCTTGTCTACACCTTGGTTTACCATATGATGGAG
CCACCGATGCAATTCTACGAGATTGTAGGCGAAGGGAACGAGATTGTGGAAGAGCCTGCA
CAGATCAGCAACTACAGTAGATCTCTGCTTCATGAAGCGGAATGGCCAGGGATGGCTGAC
AAAGAAACGGAGCACTCAAAGACGCCATTCATTGCACGGGTTTTCATGAGTATTTCAGGC
TCTTCACAGAATACATTTCCTGATATTGATTTTGCAGAAGAGGGCACTTCTGGTGCTGGA
CCTAGCAGTCCAAAATCGCTAAGGTGTTTGGCGGAGCCAAAGGTTGTAAGGAGGATCAGG
GTTGTAGCTGAGAAGACTCCAATTCAGCATGTTCTCCAGCCACCAACCATCGCCTCCTTG
CTCGCCATTGTCATCGGCATGGTTCCTTTGTTCAAAGATTTTGTGTTTGTGCCTGATGCA
CCACTGTCGTTCTTTACAGACAGTTTGGAGATTCTAGCTCAAGCCGTTGTACCCTCGGTG
ATGTTAATTCTAGGGGGCATGCTTGCAGAAGGACCCAAGGATAATGCCTTGGGTATCCGG
ACTATCACTGGTATAATTGTTGCAAGGCTCCTGATTCTCCCGTGCATTGGCATCGGTGTC
GTCCTGCTGGCAGATCGGTTGCATCTGCTTGTCGAGGAAGACCACATGTACCGCTTTGTG
CTGTCGCTACAGTACTCCACCCCTAGTGCCATCCTGCTTGGAGCGATTGCGAGCCTCAGA
GGTTATGCTGTCAAGGAAGCATCGGCACTTCTATTCTGGCAGCACATTTGTGCGGTGCTA
TCTCTCTCCATCTACCTGATCGTATATTTCAGGTTGCTTACCATTTGA

Protein

456 aa

>Os08t0191000-01 Auxin efflux carrier domain containing protein.
MDWLSANLQVNPQVTVHGDWVSAVMPLMKLLCLTVIGLVLSNPRTQIIPKATFKLLSKLV
FALFLPCLIFVHLGQSVTIQNILDWWFIPVNVLISTAIGCILGYIVALICRPPPQFFRFT
VIMTGFGNTGNLPIAIIGSVCHTTDHPFGPGCHRKGVAYVSFAQWVAVILVYTLVYHMME
PPMQFYEIVGEGNEIVEEPAQISNYSRSLLHEAEWPGMADKETEHSKTPFIARVFMSISG
SSQNTFPDIDFAEEGTSGAGPSSPKSLRCLAEPKVVRRIRVVAEKTPIQHVLQPPTIASL
LAIVIGMVPLFKDFVFVPDAPLSFFTDSLEILAQAVVPSVMLILGGMLAEGPKDNALGIR
TITGIIVARLLILPCIGIGVVLLADRLHLLVEEDHMYRFVLSLQYSTPSAILLGAIASLR
GYAVKEASALLFWQHICAVLSLSIYLIVYFRLLTI*

5'UTR

chr08:5322769..5322928 (+ strand) : 160 bp

chr08:5323267..5323422 (+ strand) : 156 bp

CDS

chr08:5323423..5324790 (+ strand) : 1368 bp

3'UTR

chr08:5324791..5325114 (+ strand) : 324 bp

FASTA

>Os08t0191000-01 class=Sequence position=chr08:5322769..5325114 (+ strand)
ACTCTTGCTT GCCTCTCTGC GTGATCCCGA TCTGCAGAGC TCGCCGCCGG CGAGCTAAGC CCCGGAGGCG CGCGCGTGGA
CGCCCCCCCC CCCCTTCTCC TCCGAGCAGC GGCCACCGGT GGCCGCCGCC GCCATCTCGG TCTCGAATCG AGGTGGACAG
GTATTCGTTC TCGTCTCCTT CCTCTTCCCC GCGCCGCTTG ATGAGTCGTT ATTAGATTGG AGATCCATCA GGGATGGCTG
GGTTGATTTG TTTCCCTCAG AATTACGCAT GAGTTTTTTT CTTACTGCGG TGGTAGTGGG TTAGTCAGCG ACAGCCGTTT
GTTACCAAGG AAAATATTTT TGGGGGTGTT GGTTTGGCTT TTGTTCTTGT TTGGTTTGTT TTGATCAGCA AAATTTTTCA
CTTTTGCATC ATCAGCAGAT CTGTCTGTCC ATTATAACCA CACTATTGAT GCTCTTATCC ATCAATTCCT GAATCATATC
CTTTCTCTTT TTTTGCAGAA AAAAGTCATC AGCTTTCTGC ATGCGATTTG GTAGATACTG ACACGTCTTG ATTCTGCTCA
AGGAAGGCAG CTGATTGATT GGTTGGGAGG GCAAACTAAA AGGGGTGTAA TCTTGGCCAA TTCGATAGAA AAACACAGAG
ATTTAGTGGC GAGAATGGAT TGGCTGTCCG CGAACCTGCA GGTGAACCCT CAGGTGACTG TCCATGGGGA CTGGGTGTCA
GCAGTCATGC CGCTGATGAA GCTGCTGTGC TTGACGGTCA TCGGCCTTGT GCTGTCCAAC CCGAGGACGC AGATCATCCC
CAAGGCCACC TTCAAGCTCC TGAGCAAGCT CGTCTTTGCG CTGTTCCTGC CATGCCTGAT CTTTGTCCAC CTTGGCCAGT
CGGTCACAAT TCAGAACATC CTCGACTGGT GGTTCATCCC GGTCAACGTG CTCATCAGCA CGGCCATCGG GTGCATTCTT
GGGTACATCG TCGCGCTGAT CTGTCGCCCG CCGCCGCAGT TTTTCAGGTT CACGGTGATC ATGACCGGAT TTGGCAACAC
GGGTAACCTC CCAATCGCGA TCATCGGGTC GGTTTGCCAT ACCACGGATC ACCCCTTTGG TCCTGGATGC CACCGCAAGG
GTGTCGCTTA TGTTTCGTTT GCTCAATGGG TCGCTGTTAT TCTTGTCTAC ACCTTGGTTT ACCATATGAT GGAGCCACCG
ATGCAATTCT ACGAGATTGT AGGCGAAGGG AACGAGATTG TGGAAGAGCC TGCACAGATC AGCAACTACA GTAGATCTCT
GCTTCATGAA GCGGAATGGC CAGGGATGGC TGACAAAGAA ACGGAGCACT CAAAGACGCC ATTCATTGCA CGGGTTTTCA
TGAGTATTTC AGGCTCTTCA CAGAATACAT TTCCTGATAT TGATTTTGCA GAAGAGGGCA CTTCTGGTGC TGGACCTAGC
AGTCCAAAAT CGCTAAGGTG TTTGGCGGAG CCAAAGGTTG TAAGGAGGAT CAGGGTTGTA GCTGAGAAGA CTCCAATTCA
GCATGTTCTC CAGCCACCAA CCATCGCCTC CTTGCTCGCC ATTGTCATCG GCATGGTTCC TTTGTTCAAA GATTTTGTGT
TTGTGCCTGA TGCACCACTG TCGTTCTTTA CAGACAGTTT GGAGATTCTA GCTCAAGCCG TTGTACCCTC GGTGATGTTA
ATTCTAGGGG GCATGCTTGC AGAAGGACCC AAGGATAATG CCTTGGGTAT CCGGACTATC ACTGGTATAA TTGTTGCAAG
GCTCCTGATT CTCCCGTGCA TTGGCATCGG TGTCGTCCTG CTGGCAGATC GGTTGCATCT GCTTGTCGAG GAAGACCACA
TGTACCGCTT TGTGCTGTCG CTACAGTACT CCACCCCTAG TGCCATCCTG CTTGGAGCGA TTGCGAGCCT CAGAGGTTAT
GCTGTCAAGG AAGCATCGGC ACTTCTATTC TGGCAGCACA TTTGTGCGGT GCTATCTCTC TCCATCTACC TGATCGTATA
TTTCAGGTTG CTTACCATTT GAAAGATGAT GGCCGGCCGC CTTCCAAAAT TGGTTTGTAG CATTCATCCT CGGAAGTGAT
TTCTAGGGAG ATGGGTACTT GAATGGATTT TCAACCACGT CTCCTTATGG TCAAGTGTAT TTATAGTATA TTTAATTTTT
TTTTAGCGAT TTATATTTCA GATACATGTA GAACTTGAGA ACATGAGATA TGTTCTTGTC GTTCATTAGT GTCAATATAT
TGCTGTTCGC TTGCACATTT CTTGATCCGA TTACAGCATT ACAGTTGCTG CTCAAAAGTT GTACAAGTAC TGCTACATTA
GAAGTCAATA TATTGCTGTT TGATGC

Locus: Os08g0191000

Loading...

Locus: Os08g0191000

Loading...