Os08t0191433-01

Locus

Os08g0191433

Description

Starch synthase, Starch biosynthesis

RAP-DB Gene Symbol Synonym(s)

SSIIIA, OsSSIIIa, SSIII-2, SS3A, OsSSSIIIa

RAP-DB Gene Name Synonym(s)

SOLUBLE STARCH SYNTHASE IIIA, SOLUBLE STARCH SYNTHASE III-2

CGSNL Gene Symbol

FLO5

CGSNL Gene Name

FLOURY ENDOSPERM 5

Oryzabase Gene Symbol Synonym(s)

OsSSIIIa, SSIII-2, SS3A, SS3a, OsSSSIIIa, SSIIIa, Flo5

Oryzabase Gene Name Synonym(s)

SOLUBLE STARCH SYNTHASE III-2, SOLUBLE STARCH SYNTHASE IIIA, floury endosperm 5

Transcript Evidence

AY100469 (indica)

Protein Evidence

Q8L8G9

Literature

PMID: 15232694

PMID: 17586688

PMID: 21595523

Note

Manual Curation

February 22, 2010

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Biological Process: glucan biosynthetic process (GO:0009250)

Molecular Function: starch synthase activity (GO:0009011)

Molecular Function: starch binding (GO:2001070)

Functional domain (InterPro)

Glycogen/starch synthase, ADP-glucose type (IPR011835)

Carbohydrate binding module family 25 (IPR005085)

Starch synthase, catalytic domain (IPR013534)

Glycosyl transferase, family 1 (IPR001296)

Expression Databases

TENOR (Os08t0191433-00)

Others

Oryzabase (6623)

Transcript

5154 bp

>Os08t0191433-01 Starch synthase, Starch biosynthesis
TCCACAGTGGGGAAAATGGATGCGGTAAATGAAGTTGGGACTGAAAATGACTTATTTGAG
GTGGATCTGTCAGCATTGCATAGTGCTGCAGTGGGGAAGGTGGATGTAGTAGATGGAGCT
AAAGCTAAAGAAGATTTGTTTGAGATGGATTCATTAGCATTGCACAGTGTTACAATGGGG
AAGGTGGATGCAATAAATGCAGCTGGAGCTGAAGGAGACAAATTTGAGGTGGATCTGTCT
GCGCTCGCGTCGAACAATTCAATGATAGAGGCAGTTAATGTGATGGATGAAGCTAAGGCT
ATAGAAGACACACTCGAGGTGGATTTGTCAGGAAATGCTACAAGCAGTTCAACATATGGG
GAAGTTAAATTTGAGGTGGATTCATTAGGAAATACTTCAAGCACTGTAATGTATGGGCCA
GCGGATGGAGCGTATGAACCTCGGTCCGATGAAGTCACTTTTAAGGTGGATTCATCAGAA
AATGCGTCAAACAATGTAATGTATGGGAGAGCAGATGTGGTGGATGAATCTTGGGCTGAT
GAAGGCATATTTGAGGTGGATTTTTTTACAAATGCTTCAAGCGGCGCAGAATATGGAAAA
GTGGATGTGGTGGATGAAGCTAAAACTGATGATTTCACATTTGAGATTGATTCATTAGAA
AAAGATTCAAACAATAAAATGCATGGGAAAGCTCATATGGTGGATGAAGCTTGGGACGAT
GAAGCCATATTTGAGGTTGATTTGTTTGGAAATGCTTCAAGCATTCCGATATATGGGGAG
GTGAATGTGTTGGATGAAGCTCGGGCTGATGATGGAAAATTTGAGGTTGACTTATTAGGG
AATACTTCTAGCAATTCAACACATGAGGAAGTGGATGTGGTAGATGAAGCTCAAACAGGT
GAAGCCACATTTGAGGTGGATTTGCTTGGAAATGCTTTAAGCAGTGCAATATATAAAGAA
GTGCCTGTCATGGGTGGAGCTCAGGATGATGAAGTTGATGTAGATTTCTCAATAAATGCT
TCAATCACCGAAACAGAAAAGGAAGCAGATGCAGTTGATGAAGCTAGAGTTGAAGATGAG
ACATTTGATATGGATTTAGTAGGTAAACAGATATCAATCGATTCTATGAATGATGATGTA
GTTGAAGAAGGGACTAAACATCACAGATATCCAATGTTGTCTTCAGCATTCATAGAAGTC
AAGACCATTCATGAAACACCTGTAAGTTTAAAGCCTGAACTTATGTCAGTTGTCATGGAT
CAGGAACAAGACAAACCAATTTCCAGCGTTTATCAACAAGAAGGATCAATTTTTAATTTG
CATGCAGAAAACCAATCAACGGTAGATTTTCATGAACGGGAGCAAATGGCTATTACTTTT
GATAAACAAAAGGAATCAGTTGCTAAACTCTCTAAAGAAGACCAACAGACTGCTGGTTTA
CCTGAGCAAAACATGTCCTTTGATGGTGTCCATAGGAAAAGCCAGTCAATTATTGGGCTC
CCATTTCAACACCAATCAATTGTTAGTTCCCCTGAAAAATACCGATCAATTGTGGGTTTT
CATGGACAAAATCAATCAATCATCAGCTCTCATAAACAAGACAAATCAATTGTTGGTGTT
CCTAAAAAAATTCAATCCATTGTTGGTTCCACTAAGCATGATGATTCAATTGTTGGTTTC
CGCAAACAAGACAGATCAATTGTTAGTGTGCCTGAGCAAAAACAATCAATAGTTGGTTTT
CATAAACAAGATCTATCAATTGTTGCTGTCAGCGAACAAAATCTATCAATTGTTGCTATA
CCTAGAGAGAGTCAATCAAAGCAAATTTCTATTGTTCGGAGACATGATCCACTACATTTG
AAGGAAGTGGAAACAAAGGATAGAGATGGCATATCTAAAAAATCTGGTGGTGACGATGAT
TTGCCACATATGCTCTTCGAAGAAGAGCTTTCACAGGTTGAAGATGTAGCAAGGGCAATC
GCCTATAAAAAGCAGCATGAAGTTGATGTAATCTCTTTGACTCCAGATATCCAGGAGTCA
CCACAGGACAATATCGACCCACAAGAACTCCGAAGGATGCTCCAAGAACTTGCTGACCAG
AATTGTTCAATGGGTAACAAGCTTTTCGTTTTTCCAGAGGCAGTGAAGGCTAATTCGACA
ATTGATGTATATTTGAATCGTAACCTATCGGCTTTGGCGAATGAGCCTGATGTCCACATC
AAAGGAGCATTCAATAGTTGGAGATGGAGGCCTTTCACCGAAAGACTGCACAAGAGTGAA
TTGAGTGGGGATTGGTGGTCTTGCAAACTGCACATACCCAAGGAAGCTTATAGATTAGAC
TTTGTGTTCTTCAATGGTCGTTTAGTCTATGATAACAATGATAGTAATGATTTTGTGCTG
CAAGTAGAAAGTACAATGGATGAAGATTCCTTTGAGGAGTTCTTGGTTGAAGAAAAGAAA
AGAGAACTTGAGAGAGTTGCCACTGAAGAAGCTGAAAGGAGGAGGCATGCTGAAGAGCAG
CAGCGAATGGGAGAACAAAGGGCTGCAGAACAAGCTGCCAGGGAACAGGCTAAGAAGGAG
ATAGAGTTGAAGAAGAACAAATTGCAAAATCTGTTGAGTTCAGCCAGAACACATGTTGAT
AATTTGTGGCACATAGAGCCTAGCACATATAGACAAGGGGACACTGTCAGATTGTACTAT
AACAGAAACTCAAGGCCGCTTATGCATAGTACTGAGATCTGGATGCATGGTGGTTGCAAT
AGTTGGACTGATGGACTCTCTATTGTTGAAAGACTTGTCGAATGTGATGACGAAAATGGT
GATTGGTGGTATGCTAATGTTCATATACCTGAAAAGGCCTTTGTATTGGACTGGGTTTTT
GCTGACGGGCCACCTGGAAATGCAAGGAATTATGACAACAATGGTCGACAAGATTTTCAT
GCTATTCTTCCAAATGCCATGACTAACGAAGAATATTGGGTTGAAGAGGAAAACTGTATC
TATACAAGGCTTCTCCACGAGATCAGAGAACGGGAGGAAGCTATTAAAATAAAGGTTGAG
AAAAGAGCAAAAATGAAATCTGAGATGAAGGAAAAGACTATGAGAATGTTTCTACTTTCT
CAGAAACACATTGTTTATACTGAACCACTTGAAATACGTGCTGGAACAACTGTGGATGTT
CTATATAATCCTTCTAATACGGTGCTGAATGGAAAGCCAGAGGTTTGGTTTAGGTGGTCC
TTTAACCGATGGATGCATCCAAGTGGTGTTTTACCACCCAAGAAGATGGTGAAAACAGAA
GATGGTTGTCACTTAAAAGCGACAGTTAGTGTTCCATCGGATGCTTATATGATGGACTTT
GTTTTCTCTGAGTCGGAAGAAGGTGGAATCTATGACAACAGGAATGGGACAGACTATCAT
ATTCCTGTTTCTGGTTCCAATGCAAAGGAGCCTCCCATTCATATTGTCCATATAGCGGTT
GAGATGGCACCCATTGCAAAGGTTGGAGGCCTTGCTGACGTTGTCACAAGTCTTTCACGT
GCAATTCAAGAGTTAGGCCATCATGTTGAGGTTATTCTCCCGAAATATAATTTTATGAAT
CAAAGCAATGTGAAGAATTTGCATGTACGTCAAAGCTTTTCTTTGGGTGGTACAGAAATT
AAAGTGTGGTTTGGACTAGTTGAAGACCTGTCTGTTTACTTCTTGGAACCTCAAAATGGG
ATGTTTGGGGGTGGATGGGTATATGGAGGGAACGATGCTGGCAGATTTGGCTTGTTCTGT
CAGTCTGCTCTAGAGTTCCTCCTTCAGAGTGGATCTTCTCCACATATAATACACTGCCAT
GATTGGTCAAGTGCACCAGTTGCCTGGCTATACAAGGAACACTATGCAGAATCCAGGTTG
GCAACTGCCCGGATTATATTTACCATCCATAATCTTGAGTTTGGAGCACATTTTATTGGA
AAAGCAATGACATACTGCGACAAAGCCACAACTGTTTCTCACACGTATTCAAAGGAAGTC
GCAGGTCATGGTGCCATAGCTCCTCATCGTGGAAAATTCTATGGAATTCTCAATGGAATT
GATCCAGATATCTGGGATCCATATACTGATAACTTCATCCCGATGCATTATACTTCTGAA
AATGTGGTTGAAGGCAAGAATGCTGCAAAGAGAGCATTGCAGCAGAGGTTTGGACTGCAG
CAGACTGATGTCCCCATTGTTGGAATCATCACTCGTCTGACAGCCCAGAAGGGTATCCAC
CTCATTAAACATGCACTTCATCGGACACTTGAACGCAATGGACAGGTGGTTTTGCTTGGT
TCAGCTCCAGATCCTCGGATACAGAGTGATTTCTGCAGATTGGCTGATAGTCTTCATGGT
GAAAACCATGGCAGGGTTAGACTATGTTTAACTTATGACGAGCCTCTCTCACACCTGATA
TATGCTGGCTCTGACTTCATCCTTGTTCCATCCATCTTTGAACCTTGCGGTTTGACTCAA
CTTGTTGCCATGCGCTATGGATCCATCCCTATTGTTCGGAAAACCGGAGGACTTTACGAC
ACTGTTTTCGACGTAGACCATGACAAAGACCGGGCTCGAGTTCTAGGCCTTGAACCAAAT
GGGTTCAGCTTTGATGGAGCTGACTGTAATGGTGTGGATTACGCCCTGAACAGAGCAATC
TCTTCTTGGTTTGAAGCCCGCGGTTGGTTCCACTCCCTCTGCAAAAGGGTCATGGAGCAA
GACTGGTCCTGGAACCGGCCTGCCCTGGACTACATTGAACTGTACCATTCAGCTCACAAA
TTTTGAGGCCCCCATCCAACGGTGGCAAGAGAAAGCAAGCATTGGCAGATACTACAAATT
AAATGAAACATGGCTCAAAGTTAAAATATTTTATCTGAGCTGCAGATACAAATTAACTCA
AACATGGTTCAAAGTTAAGATCTTTTATCTGAGCTACACATATATATGCAGAATAAAGAC
TCTTTACAGCATGCATAAACAATTGTGGGAGTATGTATCAGCTATGTTTCCTATTCTCAG
TTTTAATTATGAATACTTGATTTAGTACCAGAACCGTGTACATATGTTTGCAAAATTGCA
AGTAAAATGAAGGTGTAGAACTATAATGTTGTTCTATGGTTTCTTTTGCGCTAC

CDS

4662 bp

>Os08t0191433-01 Starch synthase, Starch biosynthesis
ATGGATTCATTAGCATTGCACAGTGTTACAATGGGGAAGGTGGATGCAATAAATGCAGCT
GGAGCTGAAGGAGACAAATTTGAGGTGGATCTGTCTGCGCTCGCGTCGAACAATTCAATG
ATAGAGGCAGTTAATGTGATGGATGAAGCTAAGGCTATAGAAGACACACTCGAGGTGGAT
TTGTCAGGAAATGCTACAAGCAGTTCAACATATGGGGAAGTTAAATTTGAGGTGGATTCA
TTAGGAAATACTTCAAGCACTGTAATGTATGGGCCAGCGGATGGAGCGTATGAACCTCGG
TCCGATGAAGTCACTTTTAAGGTGGATTCATCAGAAAATGCGTCAAACAATGTAATGTAT
GGGAGAGCAGATGTGGTGGATGAATCTTGGGCTGATGAAGGCATATTTGAGGTGGATTTT
TTTACAAATGCTTCAAGCGGCGCAGAATATGGAAAAGTGGATGTGGTGGATGAAGCTAAA
ACTGATGATTTCACATTTGAGATTGATTCATTAGAAAAAGATTCAAACAATAAAATGCAT
GGGAAAGCTCATATGGTGGATGAAGCTTGGGACGATGAAGCCATATTTGAGGTTGATTTG
TTTGGAAATGCTTCAAGCATTCCGATATATGGGGAGGTGAATGTGTTGGATGAAGCTCGG
GCTGATGATGGAAAATTTGAGGTTGACTTATTAGGGAATACTTCTAGCAATTCAACACAT
GAGGAAGTGGATGTGGTAGATGAAGCTCAAACAGGTGAAGCCACATTTGAGGTGGATTTG
CTTGGAAATGCTTTAAGCAGTGCAATATATAAAGAAGTGCCTGTCATGGGTGGAGCTCAG
GATGATGAAGTTGATGTAGATTTCTCAATAAATGCTTCAATCACCGAAACAGAAAAGGAA
GCAGATGCAGTTGATGAAGCTAGAGTTGAAGATGAGACATTTGATATGGATTTAGTAGGT
AAACAGATATCAATCGATTCTATGAATGATGATGTAGTTGAAGAAGGGACTAAACATCAC
AGATATCCAATGTTGTCTTCAGCATTCATAGAAGTCAAGACCATTCATGAAACACCTGTA
AGTTTAAAGCCTGAACTTATGTCAGTTGTCATGGATCAGGAACAAGACAAACCAATTTCC
AGCGTTTATCAACAAGAAGGATCAATTTTTAATTTGCATGCAGAAAACCAATCAACGGTA
GATTTTCATGAACGGGAGCAAATGGCTATTACTTTTGATAAACAAAAGGAATCAGTTGCT
AAACTCTCTAAAGAAGACCAACAGACTGCTGGTTTACCTGAGCAAAACATGTCCTTTGAT
GGTGTCCATAGGAAAAGCCAGTCAATTATTGGGCTCCCATTTCAACACCAATCAATTGTT
AGTTCCCCTGAAAAATACCGATCAATTGTGGGTTTTCATGGACAAAATCAATCAATCATC
AGCTCTCATAAACAAGACAAATCAATTGTTGGTGTTCCTAAAAAAATTCAATCCATTGTT
GGTTCCACTAAGCATGATGATTCAATTGTTGGTTTCCGCAAACAAGACAGATCAATTGTT
AGTGTGCCTGAGCAAAAACAATCAATAGTTGGTTTTCATAAACAAGATCTATCAATTGTT
GCTGTCAGCGAACAAAATCTATCAATTGTTGCTATACCTAGAGAGAGTCAATCAAAGCAA
ATTTCTATTGTTCGGAGACATGATCCACTACATTTGAAGGAAGTGGAAACAAAGGATAGA
GATGGCATATCTAAAAAATCTGGTGGTGACGATGATTTGCCACATATGCTCTTCGAAGAA
GAGCTTTCACAGGTTGAAGATGTAGCAAGGGCAATCGCCTATAAAAAGCAGCATGAAGTT
GATGTAATCTCTTTGACTCCAGATATCCAGGAGTCACCACAGGACAATATCGACCCACAA
GAACTCCGAAGGATGCTCCAAGAACTTGCTGACCAGAATTGTTCAATGGGTAACAAGCTT
TTCGTTTTTCCAGAGGCAGTGAAGGCTAATTCGACAATTGATGTATATTTGAATCGTAAC
CTATCGGCTTTGGCGAATGAGCCTGATGTCCACATCAAAGGAGCATTCAATAGTTGGAGA
TGGAGGCCTTTCACCGAAAGACTGCACAAGAGTGAATTGAGTGGGGATTGGTGGTCTTGC
AAACTGCACATACCCAAGGAAGCTTATAGATTAGACTTTGTGTTCTTCAATGGTCGTTTA
GTCTATGATAACAATGATAGTAATGATTTTGTGCTGCAAGTAGAAAGTACAATGGATGAA
GATTCCTTTGAGGAGTTCTTGGTTGAAGAAAAGAAAAGAGAACTTGAGAGAGTTGCCACT
GAAGAAGCTGAAAGGAGGAGGCATGCTGAAGAGCAGCAGCGAATGGGAGAACAAAGGGCT
GCAGAACAAGCTGCCAGGGAACAGGCTAAGAAGGAGATAGAGTTGAAGAAGAACAAATTG
CAAAATCTGTTGAGTTCAGCCAGAACACATGTTGATAATTTGTGGCACATAGAGCCTAGC
ACATATAGACAAGGGGACACTGTCAGATTGTACTATAACAGAAACTCAAGGCCGCTTATG
CATAGTACTGAGATCTGGATGCATGGTGGTTGCAATAGTTGGACTGATGGACTCTCTATT
GTTGAAAGACTTGTCGAATGTGATGACGAAAATGGTGATTGGTGGTATGCTAATGTTCAT
ATACCTGAAAAGGCCTTTGTATTGGACTGGGTTTTTGCTGACGGGCCACCTGGAAATGCA
AGGAATTATGACAACAATGGTCGACAAGATTTTCATGCTATTCTTCCAAATGCCATGACT
AACGAAGAATATTGGGTTGAAGAGGAAAACTGTATCTATACAAGGCTTCTCCACGAGATC
AGAGAACGGGAGGAAGCTATTAAAATAAAGGTTGAGAAAAGAGCAAAAATGAAATCTGAG
ATGAAGGAAAAGACTATGAGAATGTTTCTACTTTCTCAGAAACACATTGTTTATACTGAA
CCACTTGAAATACGTGCTGGAACAACTGTGGATGTTCTATATAATCCTTCTAATACGGTG
CTGAATGGAAAGCCAGAGGTTTGGTTTAGGTGGTCCTTTAACCGATGGATGCATCCAAGT
GGTGTTTTACCACCCAAGAAGATGGTGAAAACAGAAGATGGTTGTCACTTAAAAGCGACA
GTTAGTGTTCCATCGGATGCTTATATGATGGACTTTGTTTTCTCTGAGTCGGAAGAAGGT
GGAATCTATGACAACAGGAATGGGACAGACTATCATATTCCTGTTTCTGGTTCCAATGCA
AAGGAGCCTCCCATTCATATTGTCCATATAGCGGTTGAGATGGCACCCATTGCAAAGGTT
GGAGGCCTTGCTGACGTTGTCACAAGTCTTTCACGTGCAATTCAAGAGTTAGGCCATCAT
GTTGAGGTTATTCTCCCGAAATATAATTTTATGAATCAAAGCAATGTGAAGAATTTGCAT
GTACGTCAAAGCTTTTCTTTGGGTGGTACAGAAATTAAAGTGTGGTTTGGACTAGTTGAA
GACCTGTCTGTTTACTTCTTGGAACCTCAAAATGGGATGTTTGGGGGTGGATGGGTATAT
GGAGGGAACGATGCTGGCAGATTTGGCTTGTTCTGTCAGTCTGCTCTAGAGTTCCTCCTT
CAGAGTGGATCTTCTCCACATATAATACACTGCCATGATTGGTCAAGTGCACCAGTTGCC
TGGCTATACAAGGAACACTATGCAGAATCCAGGTTGGCAACTGCCCGGATTATATTTACC
ATCCATAATCTTGAGTTTGGAGCACATTTTATTGGAAAAGCAATGACATACTGCGACAAA
GCCACAACTGTTTCTCACACGTATTCAAAGGAAGTCGCAGGTCATGGTGCCATAGCTCCT
CATCGTGGAAAATTCTATGGAATTCTCAATGGAATTGATCCAGATATCTGGGATCCATAT
ACTGATAACTTCATCCCGATGCATTATACTTCTGAAAATGTGGTTGAAGGCAAGAATGCT
GCAAAGAGAGCATTGCAGCAGAGGTTTGGACTGCAGCAGACTGATGTCCCCATTGTTGGA
ATCATCACTCGTCTGACAGCCCAGAAGGGTATCCACCTCATTAAACATGCACTTCATCGG
ACACTTGAACGCAATGGACAGGTGGTTTTGCTTGGTTCAGCTCCAGATCCTCGGATACAG
AGTGATTTCTGCAGATTGGCTGATAGTCTTCATGGTGAAAACCATGGCAGGGTTAGACTA
TGTTTAACTTATGACGAGCCTCTCTCACACCTGATATATGCTGGCTCTGACTTCATCCTT
GTTCCATCCATCTTTGAACCTTGCGGTTTGACTCAACTTGTTGCCATGCGCTATGGATCC
ATCCCTATTGTTCGGAAAACCGGAGGACTTTACGACACTGTTTTCGACGTAGACCATGAC
AAAGACCGGGCTCGAGTTCTAGGCCTTGAACCAAATGGGTTCAGCTTTGATGGAGCTGAC
TGTAATGGTGTGGATTACGCCCTGAACAGAGCAATCTCTTCTTGGTTTGAAGCCCGCGGT
TGGTTCCACTCCCTCTGCAAAAGGGTCATGGAGCAAGACTGGTCCTGGAACCGGCCTGCC
CTGGACTACATTGAACTGTACCATTCAGCTCACAAATTTTGA

Protein

1554 aa

>Os08t0191433-01 Starch synthase, Starch biosynthesis
MDSLALHSVTMGKVDAINAAGAEGDKFEVDLSALASNNSMIEAVNVMDEAKAIEDTLEVD
LSGNATSSSTYGEVKFEVDSLGNTSSTVMYGPADGAYEPRSDEVTFKVDSSENASNNVMY
GRADVVDESWADEGIFEVDFFTNASSGAEYGKVDVVDEAKTDDFTFEIDSLEKDSNNKMH
GKAHMVDEAWDDEAIFEVDLFGNASSIPIYGEVNVLDEARADDGKFEVDLLGNTSSNSTH
EEVDVVDEAQTGEATFEVDLLGNALSSAIYKEVPVMGGAQDDEVDVDFSINASITETEKE
ADAVDEARVEDETFDMDLVGKQISIDSMNDDVVEEGTKHHRYPMLSSAFIEVKTIHETPV
SLKPELMSVVMDQEQDKPISSVYQQEGSIFNLHAENQSTVDFHEREQMAITFDKQKESVA
KLSKEDQQTAGLPEQNMSFDGVHRKSQSIIGLPFQHQSIVSSPEKYRSIVGFHGQNQSII
SSHKQDKSIVGVPKKIQSIVGSTKHDDSIVGFRKQDRSIVSVPEQKQSIVGFHKQDLSIV
AVSEQNLSIVAIPRESQSKQISIVRRHDPLHLKEVETKDRDGISKKSGGDDDLPHMLFEE
ELSQVEDVARAIAYKKQHEVDVISLTPDIQESPQDNIDPQELRRMLQELADQNCSMGNKL
FVFPEAVKANSTIDVYLNRNLSALANEPDVHIKGAFNSWRWRPFTERLHKSELSGDWWSC
KLHIPKEAYRLDFVFFNGRLVYDNNDSNDFVLQVESTMDEDSFEEFLVEEKKRELERVAT
EEAERRRHAEEQQRMGEQRAAEQAAREQAKKEIELKKNKLQNLLSSARTHVDNLWHIEPS
TYRQGDTVRLYYNRNSRPLMHSTEIWMHGGCNSWTDGLSIVERLVECDDENGDWWYANVH
IPEKAFVLDWVFADGPPGNARNYDNNGRQDFHAILPNAMTNEEYWVEEENCIYTRLLHEI
REREEAIKIKVEKRAKMKSEMKEKTMRMFLLSQKHIVYTEPLEIRAGTTVDVLYNPSNTV
LNGKPEVWFRWSFNRWMHPSGVLPPKKMVKTEDGCHLKATVSVPSDAYMMDFVFSESEEG
GIYDNRNGTDYHIPVSGSNAKEPPIHIVHIAVEMAPIAKVGGLADVVTSLSRAIQELGHH
VEVILPKYNFMNQSNVKNLHVRQSFSLGGTEIKVWFGLVEDLSVYFLEPQNGMFGGGWVY
GGNDAGRFGLFCQSALEFLLQSGSSPHIIHCHDWSSAPVAWLYKEHYAESRLATARIIFT
IHNLEFGAHFIGKAMTYCDKATTVSHTYSKEVAGHGAIAPHRGKFYGILNGIDPDIWDPY
TDNFIPMHYTSENVVEGKNAAKRALQQRFGLQQTDVPIVGIITRLTAQKGIHLIKHALHR
TLERNGQVVLLGSAPDPRIQSDFCRLADSLHGENHGRVRLCLTYDEPLSHLIYAGSDFIL
VPSIFEPCGLTQLVAMRYGSIPIVRKTGGLYDTVFDVDHDKDRARVLGLEPNGFSFDGAD
CNGVDYALNRAISSWFEARGWFHSLCKRVMEQDWSWNRPALDYIELYHSAHKF*

5'UTR

chr08:5353697..5353840 (+ strand) : 144 bp

CDS

chr08:5353841..5356535 (+ strand) : 2695 bp

chr08:5356719..5356933 (+ strand) : 215 bp

chr08:5357467..5357737 (+ strand) : 271 bp

chr08:5358330..5358505 (+ strand) : 176 bp

chr08:5358631..5358738 (+ strand) : 108 bp

chr08:5359165..5359274 (+ strand) : 110 bp

chr08:5360635..5360737 (+ strand) : 103 bp

chr08:5361002..5361172 (+ strand) : 171 bp

chr08:5361296..5361424 (+ strand) : 129 bp

chr08:5361666..5361848 (+ strand) : 183 bp

chr08:5361956..5362087 (+ strand) : 132 bp

chr08:5362167..5362278 (+ strand) : 112 bp

chr08:5362444..5362567 (+ strand) : 124 bp

chr08:5362796..5362928 (+ strand) : 133 bp

3'UTR

chr08:5362929..5363276 (+ strand) : 348 bp

FASTA

>Os08t0191433-01 class=Sequence position=chr08:5353697..5363276 (+ strand)
TCCACAGTGG GGAAAATGGA TGCGGTAAAT GAAGTTGGGA CTGAAAATGA CTTATTTGAG GTGGATCTGT CAGCATTGCA
TAGTGCTGCA GTGGGGAAGG TGGATGTAGT AGATGGAGCT AAAGCTAAAG AAGATTTGTT TGAGATGGAT TCATTAGCAT
TGCACAGTGT TACAATGGGG AAGGTGGATG CAATAAATGC AGCTGGAGCT GAAGGAGACA AATTTGAGGT GGATCTGTCT
GCGCTCGCGT CGAACAATTC AATGATAGAG GCAGTTAATG TGATGGATGA AGCTAAGGCT ATAGAAGACA CACTCGAGGT
GGATTTGTCA GGAAATGCTA CAAGCAGTTC AACATATGGG GAAGTTAAAT TTGAGGTGGA TTCATTAGGA AATACTTCAA
GCACTGTAAT GTATGGGCCA GCGGATGGAG CGTATGAACC TCGGTCCGAT GAAGTCACTT TTAAGGTGGA TTCATCAGAA
AATGCGTCAA ACAATGTAAT GTATGGGAGA GCAGATGTGG TGGATGAATC TTGGGCTGAT GAAGGCATAT TTGAGGTGGA
TTTTTTTACA AATGCTTCAA GCGGCGCAGA ATATGGAAAA GTGGATGTGG TGGATGAAGC TAAAACTGAT GATTTCACAT
TTGAGATTGA TTCATTAGAA AAAGATTCAA ACAATAAAAT GCATGGGAAA GCTCATATGG TGGATGAAGC TTGGGACGAT
GAAGCCATAT TTGAGGTTGA TTTGTTTGGA AATGCTTCAA GCATTCCGAT ATATGGGGAG GTGAATGTGT TGGATGAAGC
TCGGGCTGAT GATGGAAAAT TTGAGGTTGA CTTATTAGGG AATACTTCTA GCAATTCAAC ACATGAGGAA GTGGATGTGG
TAGATGAAGC TCAAACAGGT GAAGCCACAT TTGAGGTGGA TTTGCTTGGA AATGCTTTAA GCAGTGCAAT ATATAAAGAA
GTGCCTGTCA TGGGTGGAGC TCAGGATGAT GAAGTTGATG TAGATTTCTC AATAAATGCT TCAATCACCG AAACAGAAAA
GGAAGCAGAT GCAGTTGATG AAGCTAGAGT TGAAGATGAG ACATTTGATA TGGATTTAGT AGGTAAACAG ATATCAATCG
ATTCTATGAA TGATGATGTA GTTGAAGAAG GGACTAAACA TCACAGATAT CCAATGTTGT CTTCAGCATT CATAGAAGTC
AAGACCATTC ATGAAACACC TGTAAGTTTA AAGCCTGAAC TTATGTCAGT TGTCATGGAT CAGGAACAAG ACAAACCAAT
TTCCAGCGTT TATCAACAAG AAGGATCAAT TTTTAATTTG CATGCAGAAA ACCAATCAAC GGTAGATTTT CATGAACGGG
AGCAAATGGC TATTACTTTT GATAAACAAA AGGAATCAGT TGCTAAACTC TCTAAAGAAG ACCAACAGAC TGCTGGTTTA
CCTGAGCAAA ACATGTCCTT TGATGGTGTC CATAGGAAAA GCCAGTCAAT TATTGGGCTC CCATTTCAAC ACCAATCAAT
TGTTAGTTCC CCTGAAAAAT ACCGATCAAT TGTGGGTTTT CATGGACAAA ATCAATCAAT CATCAGCTCT CATAAACAAG
ACAAATCAAT TGTTGGTGTT CCTAAAAAAA TTCAATCCAT TGTTGGTTCC ACTAAGCATG ATGATTCAAT TGTTGGTTTC
CGCAAACAAG ACAGATCAAT TGTTAGTGTG CCTGAGCAAA AACAATCAAT AGTTGGTTTT CATAAACAAG ATCTATCAAT
TGTTGCTGTC AGCGAACAAA ATCTATCAAT TGTTGCTATA CCTAGAGAGA GTCAATCAAA GCAAATTTCT ATTGTTCGGA
GACATGATCC ACTACATTTG AAGGAAGTGG AAACAAAGGA TAGAGATGGC ATATCTAAAA AATCTGGTGG TGACGATGAT
TTGCCACATA TGCTCTTCGA AGAAGAGCTT TCACAGGTTG AAGATGTAGC AAGGGCAATC GCCTATAAAA AGCAGCATGA
AGTTGATGTA ATCTCTTTGA CTCCAGATAT CCAGGAGTCA CCACAGGACA ATATCGACCC ACAAGAACTC CGAAGGATGC
TCCAAGAACT TGCTGACCAG AATTGTTCAA TGGGTAACAA GCTTTTCGTT TTTCCAGAGG CAGTGAAGGC TAATTCGACA
ATTGATGTAT ATTTGAATCG TAACCTATCG GCTTTGGCGA ATGAGCCTGA TGTCCACATC AAAGGAGCAT TCAATAGTTG
GAGATGGAGG CCTTTCACCG AAAGACTGCA CAAGAGTGAA TTGAGTGGGG ATTGGTGGTC TTGCAAACTG CACATACCCA
AGGAAGCTTA TAGATTAGAC TTTGTGTTCT TCAATGGTCG TTTAGTCTAT GATAACAATG ATAGTAATGA TTTTGTGCTG
CAAGTAGAAA GTACAATGGA TGAAGATTCC TTTGAGGAGT TCTTGGTTGA AGAAAAGAAA AGAGAACTTG AGAGAGTTGC
CACTGAAGAA GCTGAAAGGA GGAGGCATGC TGAAGAGCAG CAGCGAATGG GAGAACAAAG GGCTGCAGAA CAAGCTGCCA
GGGAACAGGC TAAGAAGGAG ATAGAGTTGA AGAAGAACAA ATTGCAAAAT CTGTTGAGTT CAGCCAGAAC ACATGTTGAT
AATTTGTGGC ACATAGAGCC TAGCACATAT AGACAAGGGG ACACTGTCAG ATTGTACTAT AACAGAAACT CAAGGCCGCT
TATGCATAGT ACTGAGATCT GGATGCATGG TGGTTGCAAT AGTTGGACTG ATGGACTCTC TATTGTTGAA AGACTTGTCG
AATGTGATGA CGAAAATGGT GATTGGTGGT ATGCTAATGG TATGATATTA CACATTTTTC TCTTACTTGG GTAGGAGTAT
ATTAGAGCAT CATAAGATAC ATTACCACAT TAGCGTAGGG CTTCTAGAAA AAAAAATCCT TGTTCTAGTT ATCTTGCACT
CTTATTTTTT TGGTTTACTT GGGTAAGAAT ATATGTAATG CATTGCTTTT CGTTTTAAAC AGTTCATATA CCTGAAAAGG
CCTTTGTATT GGACTGGGTT TTTGCTGACG GGCCACCTGG AAATGCAAGG AATTATGACA ACAATGGTCG ACAAGATTTT
CATGCTATTC TTCCAAATGC CATGACTAAC GAAGAATATT GGGTTGAAGA GGAAAACTGT ATCTATACAA GGCTTCTCCA
CGAGATCAGA GAACGGGAGG AAGCTATTAA AATAAAGGTC AGTCAAAATA GAATCTTTAA ATATGGACTT GGTTATTTGA
TCCAGAGTTT TACAACATGG TTCTGATGTA TTTTGTTGGC TGACGAATTC TCTTGCAATT GTTCTATTTG TAATTAACTT
GCGTAGAGCT AATGAACTTC ACATGTGAAA TCAGGTTTTT GACCAACCGA TTACCTTCTT TTTTTTTGTG GGGATGTTTT
TGACCAAATA AGTTACTATT TCACATCCTA AGACATGTTA TAAAATTCAT CCAAACTCAG TATTCTTTCA AATATACAAT
AATTAATTTG ACCAGTTAGA TCATTCTTCA CTTTGAACTT GTGCCTTAAG CTGACTGTTT TGACCAAACG AATTGATGGC
CCACCCAGTT AGCAGTTAGC ACTATTTATT GGAACTTCTG TTATACCATA TTATATTATT CAAGGAAAAA TGTAGTTGTT
CACTGTCATG TATATATCTT GATGTTTTGA ACATCAGATA TATGTTGTGA AGTCCTTCGG CTTACTATTC CCACTTTTTT
GCTTGTACAG GTTGAGAAAA GAGCAAAAAT GAAATCTGAG ATGAAGGAAA AGACTATGAG AATGTTTCTA CTTTCTCAGA
AACACATTGT TTATACTGAA CCACTTGAAA TACGTGCTGG AACAACTGTG GATGTTCTAT ATAATCCTTC TAATACGGTG
CTGAATGGAA AGCCAGAGGT TTGGTTTAGG TGGTCCTTTA ACCGATGGAT GCATCCAAGT GGTGTTTTAC CACCCAAGAA
GATGGTGAAA ACAGAAGATG GTTGTCACTT AAAAGCGACA GGTTTGAGCT TGACTTGTTA CATTGTTCCT TTTAATGCTG
ATAGATTTAT ATGATACATG TACTGATGTG CACTTTTATC CATTAATATA TATTATTAAG TGCTACTGGA CCATTAATTG
ATCAAGCACT GTTGAAGTAT ATGTCTAGCA ATGTTCCAAC TTTGATCCAT AAATGGTATC TAGTACCAAT TTTGAAACCT
GAATCACAAG GTGACATAAT TATACTATTC TGAAGAGCTA GCTAGTTTAG TGCCTAAATG AGCTACGACA ATTCTGTAAC
TGGAGTTTTC TAAATGTTAT AACTGCAAAA AATCTAGCTG GTTTACTGTA GACATAATTC ATTATAATAT CTAGTATATC
GCAGTCTAAC CCAGAAGAGC TCAAAATTTC AAACTACTTT GGATTATTAC TCAACTCTTG GTAAAAGGTG GCAATTTGGT
GATTAAACTC AATAATGTCC TGTCAAAATT TACCTTTTAT GTTTAACTTA TTTTGGAACT TTGGTTGGTA TATCGTTCAG
TTTACTCAAT ATTACAGTGT AATACATTTT TTCCCTTCCA TATTCATTAG TCCCTGTTAT GTTCCTTCTC CAGTTAGTGT
TCCATCGGAT GCTTATATGA TGGACTTTGT TTTCTCTGAG TCGGAAGAAG GTGGAATCTA TGACAACAGG AATGGGACAG
ACTATCATAT TCCTGTTTCT GGTTCCAATG CAAAGGAGCC TCCCATTCAT ATTGTCCATA TAGCGGTTGA GATGGCACCC
ATTGCAAAGG TAAGCCATAT TACCATGTAA AATTTTCTGT GGCTAGCAAC AGTGCTAGAC ATCAACACTT GCCAAGTTAT
CTGTTATTTC TATGTGCATA AAGTAATGCC ATACTCTGTA ATCTCCAATT ACAGGTTGGA GGCCTTGCTG ACGTTGTCAC
AAGTCTTTCA CGTGCAATTC AAGAGTTAGG CCATCATGTT GAGGTTATTC TCCCGAAATA TAATTTTATG AATCAAAGCA
ATGTAAGTTC AAGTAGCACA ACAGCCTATG TTTCTCCTAT TATATAATAT ATTATTTATT TATTTTCGGT TTCTGTGGTG
GTTTTGTCGC TAAGAAACTC AAATCGAAGA GCTCTCTATT TTAAGAGAGT CTATTACGAT ACTGTATATG GATGTGCTCC
GTGTTGTCCT TCCTTTCTCA GTTAGTTAGG ATTTGTGTTA GATATGTGGA TTGCTGTCAA ATATTCGAAA TGTACCTTAA
TATATCATAT ACAATTCTAG TTCTAAATTT TGTATTATTT GAAAAAAAAT AACTTTTTCA TGTCTTGTCC TTGATGCACA
AGAACTATGG AGGCAAAGAG GACTTGTCAA GTGTAGCAGA GAACTCAAGA ATATAGAAAA GTGGATTTTA TATCTTGTAT
GAACCATGTT TCATCCGTTT CAATGCAGGT GAAGAATTTG CATGTACGTC AAAGCTTTTC TTTGGGTGGT ACAGAAATTA
AAGTGTGGTT TGGACTAGTT GAAGACCTGT CTGTTTACTT CTTGGAACCT CAAAATGGGT ATGTTGCATC TCATTCTTCA
CACAAACATA GCTATTAGTC TATTACTCTT GTTTCACGAA AACCATCATC CCTAATCCTT ATACTAGCTA ATGCACAGTT
CACTAAGCCT AAGATGCAGG GTATGATATC CTTCTAAAAA CCAATTGTTG GTTCCTGTCG AGTACAAGAG CTAACTTAGt
actccctctg ttttttaata gatgacgccg ttgacttttt ctcacatgtt tgaccattcg tcttattcaa aaattttatg
caaatgtata cgatataaat cacacttaaa gaactatgag tgataaaaca actcataaca aaataaatta taattccgta
aatattttga ataagacgaa tggtcaaaca tgtgagaaag tcaacggcgt catctattaa aaaacggagg tagtaCCAGT
TATTCAAACC TTGGCCAGTT TAGGCCCTTC TTTTGATCCC TCCTTCCACT GCAGTATGCA TATTATTATT TTTTTTCAAG
TATGTGATAC AAATCTGAAA TCTAAATATA AGAATTAAAG GTACAATCAC CAAATGCAAC CCACCAGAAG TATAATGATT
TCGATTTTTT TTTTCATTTT TAGTCTTCAA TATCATTCTC TTTCTTTGTT TCCATGTTTT GCCTCAGCTG GTAGTCTGAG
CAGAATAGTT CTGTTCTAAG CTTAGATTGC AAAATTGTTT TTGAGAATCC ATGTAATGTG TTTTGCCGCT CCTTAGCATG
GATGGTGGTT TAAATCTTTT CCCTTAATAC GAAGATATGC AAATCTTTTT CTTAGTTTGG GTCGCAAAAT TGTTTGTGAT
TTTTTTGAGA ATGTTATGCA CTGATCATGA TTCTACTTCA GTTATTAGAA TTGGTATCTT TAGTCCTCTA ACCTTGACCA
AACAATTGTG ACCTATTCAG CTCTTTGACT AGGCATAAGG ACCTAGCCAG GGTTAAAGAG TTTGCTGGTT CGAGCTCAAA
TCAGGATATC TGAGAACAAC CTGGCCTTGC CCTTTCTCAG CCTATATTGG CCTTTACTGG GAACACAAAT TGCTTGGGTA
GCATTAGTAT TTAGCTAGTT TATATTTATT TCGATTTTTG CTCTACCATA TCCATGAACT GCAAGTTCTC TACACAACTT
CATGGCGCTG AATTGACAGA AGAACATTTG TAAGATGCAC CAGGGCTTAG GTGATTACAC CACACTGTAC TATAATTCAT
ACACATGCTA GTATAATTAT TTACTCCTGA CTGGTTCAGT TCCTGTATGA TGATTTCAGT TATCGCAGGA ACTGTTTTGG
AGATTGTTTC CTTGTAGGTG GCTTCACAGA ATAATCAATT TGGCATGTCT TGTGGCAGGA TGTTTGGGGG TGGATGGGTA
TATGGAGGGA ACGATGCTGG CAGATTTGGC TTGTTCTGTC AGTCTGCTCT AGAGTTCCTC CTTCAGAGTG GATCTTCTCC
AGTAAGTATT TCTCTAATTG AAAACTTCCA AGTCCAAAAT CAGTGATAAA AGAGAATTTT TTACTTTTGG TAATAAATAT
ATTGTTTTTT CCTCTTGATA TTTTCTTCAC GTTCTTGTTT TCCATGCTTG CATTTCATTA TGTCAAAACA TGTTTAAGTC
ACTGACTTAT TTGCTGCATT AGCCTTTTCT TTCCCAGTCA CTTTTTCACC TTACATTCAC TTTACTCCTC TTTTCAAAAA
GAGTGACATT TTATCGTCCT GACAGCATAT AATACACTGC CATGATTGGT CAAGTGCACC AGTTGCCTGG CTATACAAGG
AACACTATGC AGAATCCAGG TTGGCAACTG CCCGGATTAT ATTTACCATC CATAATCTTG AGTTTGGAGC ACATTTTATT
GGAAAAGCAA TGACATACTG CGACAAAGCC ACAACTGTGA GTGCCTGATT GTCTTGAAGA GTTTTATCAT CTAGTTTGGT
GCATTTTCAT GTTATATGAA AAATAAAATT ATTTTCATAT GTTCAAACAT CTTCATGTCT GTCTTGCCAT ACCTTGCAGG
TTTCTCACAC GTATTCAAAG GAAGTCGCAG GTCATGGTGC CATAGCTCCT CATCGTGGAA AATTCTATGG AATTCTCAAT
GGAATTGATC CAGATATCTG GGATCCATAT ACTGATAACT TCATCCCGGT ATAGTCATGA TAGTCGAATA CATTTTTATA
CAACTACCAG TCCATATGTA TTTGATCTTG GTAAACTAAA ACAAAGTTTG CTTGGGTTGC CAATTATGCG CACTCATAAG
ATTATCACTT TAACTAATAC TTTTGTGATA GTTGTCCTAA TATGTAATTA TTGAAAGTGC AAATGCACAC TGATGCCACA
GTATTGCCCC AAACATTTTT CATGTTTTGC TTATTTCATC CTATGTCAGA TGCATTATAC TTCTGAAAAT GTGGTTGAAG
GCAAGAATGC TGCAAAGAGA GCATTGCAGC AGAGGTTTGG ACTGCAGCAG ACTGATGTCC CCATTGTTGG AATCATCACT
CGTCTGACAG CCCAGAAGGG TATCCACCTC ATTAAACATG CACTTCATCG GACACTTGAA CGCAATGGAC AGGTTAATCA
TTTGATGACA ATCTTCTAGT GTCTCCCTAG AACTTGCTTT TCCCTTTCGC AATTATTTTT GCCGACCTAT CTGAAACAAG
TGATGTGTTT GCTTTTTAGG TGGTTTTGCT TGGTTCAGCT CCAGATCCTC GGATACAGAG TGATTTCTGC AGATTGGCTG
ATAGTCTTCA TGGTGAAAAC CATGGCAGGG TTAGACTATG TTTAACTTAT GACGAGCCTC TCTCACACCT GGTCAGTTCC
AATATCCTAC ACCATCAAAT TGGTCTAAAA AAATTGTTGC TGGCTAATAA TTTCAGTGAT TCTGCTACAG ATATATGCTG
GCTCTGACTT CATCCTTGTT CCATCCATCT TTGAACCTTG CGGTTTGACT CAACTTGTTG CCATGCGCTA TGGATCCATC
CCTATTGTTC GGAAAACCGG AGGTGAGTGT ACATAATAAC ATGTACATAT ATGAGCTTTC TTACTGACCT CAAGGACCAT
AAAAATGCTT TACATACATA GATAGCTTAC TGGTACTCCT ATGATTCATT CTCTCCTTTC TTTGCACATC ATGAGCTGAA
CGTGAATCCT ATTTTCTTCA CGCGCAGGAC TTTACGACAC TGTTTTCGAC GTAGACCATG ACAAAGACCG GGCTCGAGTT
CTAGGCCTTG AACCAAATGG GTTCAGCTTT GATGGAGCTG ACTGTAATGG TGTGGATTAC GCCCTGAACA GGCAAGTACC
TCCACACCTC ACAATTGTGT GAATGCACAA TTGAGCTGAA CATAATCGTA CAGAACCCCG AGCCAAATTC ATCATGTGAC
ATCCGTGTGG TTTGTGTGCT TGGTGGTCTA TTGTTTATGT GTCTTCCATG TAATCGCAAA CAAAAAAAGA AGAAGAATTA
TCTTCCCTAA TTCAATCATA TATTATCTTA TTCATGCAAT GTTTGCTACC CTTTTGCAGA GCAATCTCTT CTTGGTTTGA
AGCCCGCGGT TGGTTCCACT CCCTCTGCAA AAGGGTCATG GAGCAAGACT GGTCCTGGAA CCGGCCTGCC CTGGACTACA
TTGAACTGTA CCATTCAGCT CACAAATTTT GAGGCCCCCA TCCAACGGTG GCAAGAGAAA GCAAGCATTG GCAGATACTA
CAAATTAAAT GAAACATGGC TCAAAGTTAA AATATTTTAT CTGAGCTGCA GATACAAATT AACTCAAACA TGGTTCAAAG
TTAAGATCTT TTATCTGAGC TACACATATA TATGCAGAAT AAAGACTCTT TACAGCATGC ATAAACAATT GTGGGAGTAT
GTATCAGCTA TGTTTCCTAT TCTCAGTTTT AATTATGAAT ACTTGATTTA GTACCAGAAC CGTGTACATA TGTTTGCAAA
ATTGCAAGTA AAATGAAGGT GTAGAACTAT AATGTTGTTC TATGGTTTCT TTTGCGCTAC