Os08t0191433-02

Locus

Os08g0191433

Description

Starch synthase, Starch biosynthesis, Amylopectin synthesis

RAP-DB Gene Symbol Synonym(s)

SSIIIa

RAP-DB Gene Name Synonym(s)

soluble starch synthase IIIa

CGSNL Gene Symbol

FLO5

CGSNL Gene Name

FLOURY ENDOSPERM 5

Oryzabase Gene Symbol Synonym(s)

OsSSIIIa, SSIII-2, SS3A, SS3a, OsSSSIIIa, SSIIIa, Flo5

Oryzabase Gene Name Synonym(s)

SOLUBLE STARCH SYNTHASE III-2, SOLUBLE STARCH SYNTHASE IIIA, floury endosperm 5

Transcript Evidence

Inferred from literature

Protein Evidence

A0A0P0XCU3-2

Literature

PMID: 28088172

PMID: 27791174

PMID: 21730357

Note

Manual Curation

May 9, 2019

Gene Ontology (GO)

Molecular Function: glycogen (starch) synthase activity (GO:0004373)

Molecular Function: starch binding (GO:2001070)

Functional domain (InterPro)

Immunoglobulin-like fold (IPR013783)

Bacterial/plant glycogen synthase (IPR011835)

Carbohydrate binding module family 25 (IPR005085)

Starch synthase, catalytic domain (IPR013534)

Glycosyl transferase, family 1 (IPR001296)

Others

Oryzabase (6623)

Transcript

5367 bp

>Os08t0191433-02 Starch synthase, Starch biosynthesis, Amylopectin synthesis
ATGGAGATGGCTCTCCGGCCTCAAAGCCTTCTATGCCCTCGGAGCAGGCTGAAGGTCGTC
ATCCGGCCAGCTAGCAGTGCCAGCGGTGGTGGCCTCGCGCAGTATTTCTTAATGACCAGG
AGATATACTGGAAGCAGAATTGTTCGATGCATGGTTTCAAGTTCAGACTGTCCTAATAGG
AAAGCAAAGAGGACGATTTCCCTTCATACGGAAGTCGCTTCTTCTAGGGGATATGCTCCG
AGAATTGCTGCTGAATCAAGTATTCAGGAGCGAGAACATATTAATAGTGATGAAGAAACA
TTTGATACGTACAACAGATTACTACGTAATGAGTCAACAGAGTGGAAAAAGTTAGATACT
ACTGAAGTGGATTTGTCACAAGATGTTTCAAGCAGTTCAATGAGGAAAGTGGATGCGACG
GATGAAGCTAAGCTAGATATACTTGAGGATGATTTGCCCAGAAATTTGTTGAACGGTGTA
ACAATGGGGGAAGTAGATATGTTGGATGAAGCTGGGGCAGAAGATGATGTATTTGAGGTG
GACTTGTCAGCCTTGCATAATTCCACAGTGGGGAAAATGGATGCGGTAAATGAAGTTGGG
ACTGAAAATGACTTATTTGAGGTGGATCTGTCAGCATTGCATAGTGCTGCAGTGGGGAAG
GTGGATGTAGTAGATGGAGCTAAAGCTAAAGAAGATTTGTTTGAGATGGATTCATTAGCA
TTGCACAGTGTTACAATGGGGAAGGTGGATGCAATAAATGCAGCTGGAGCTGAAGGAGAC
AAATTTGAGGTGGATCTGTCTGCGCTCGCGTCGAACAATTCAATGATAGAGGCAGTTAAT
GTGATGGATGAAGCTAAGGCTATAGAAGACACACTCGAGGTGGATTTGTCAGGAAATGCT
ACAAGCAGTTCAACATATGGGGAAGTTAAATTTGAGGTGGATTCATTAGGAAATACTTCA
AGCACTGTAATGTATGGGCCAGCGGATGGAGCGTATGAACCTCGGTCCGATGAAGTCACT
TTTAAGGTGGATTCATCAGAAAATGCGTCAAACAATGTAATGTATGGGAGAGCAGATGTG
GTGGATGAATCTTGGGCTGATGAAGGCATATTTGAGGTGGATTTTTTTACAAATGCTTCA
AGCGGCGCAGAATATGGAAAAGTGGATGTGGTGGATGAAGCTAAAACTGATGATTTCACA
TTTGAGATTGATTCATTAGAAAAAGATTCAAACAATAAAATGCATGGGAAAGCTCATATG
GTGGATGAAGCTTGGGACGATGAAGCCATATTTGAGGTTGATTTGTTTGGAAATGCTTCA
AGCATTCCGATATATGGGGAGGTGAATGTGTTGGATGAAGCTCGGGCTGATGATGGAAAA
TTTGAGGTTGACTTATTAGGGAATACTTCTAGCAATTCAACACATGAGGAAGTGGATGTG
GTAGATGAAGCTCAAACAGGTGAAGCCACATTTGAGGTGGATTTGCTTGGAAATGCTTTA
AGCAGTGCAATATATAAAGAAGTGCCTGTCATGGGTGGAGCTCAGGATGATGAAGTTGAT
GTAGATTTCTCAATAAATGCTTCAATCACCGAAACAGAAAAGGAAGCAGATGCAGTTGAT
GAAGCTAGAGTTGAAGATGAGACATTTGATATGGATTTAGTAGGTAAACAGATATCAATC
GATTCTATGAATGATGATGTAGTTGAAGAAGGGACTAAACATCACAGATATCCAATGTTG
TCTTCAGCATTCATAGAAGTCAAGACCATTCATGAAACACCTGTAAGTTTAAAGCCTGAA
CTTATGTCAGTTGTCATGGATCAGGAACAAGACAAACCAATTTCCAGCGTTTATCAACAA
GAAGGATCAATTTTTAATTTGCATGCAGAAAACCAATCAACGGTAGATTTTCATGAACGG
GAGCAAATGGCTATTACTTTTGATAAACAAAAGGAATCAGTTGCTAAACTCTCTAAAGAA
GACCAACAGACTGCTGGTTTACCTGAGCAAAACATGTCCTTTGATGGTGTCCATAGGAAA
AGCCAGTCAATTATTGGGCTCCCATTTCAACACCAATCAATTGTTAGTTCCCCTGAAAAA
TACCGATCAATTGTGGGTTTTCATGGACAAAATCAATCAATCATCAGCTCTCATAAACAA
GACAAATCAATTGTTGGTGTTCCTAAAAAAATTCAATCCATTGTTGGTTCCACTAAGCAT
GATGATTCAATTGTTGGTTTCCGCAAACAAGACAGATCAATTGTTAGTGTGCCTGAGCAA
AAACAATCAATAGTTGGTTTTCATAAACAAGATCTATCAATTGTTGCTGTCAGCGAACAA
AATCTATCAATTGTTGCTATACCTAGAGAGAGTCAATCAAAGCAAATTTCTATTGTTCGG
AGACATGATCCACTACATTTGAAGGAAGTGGAAACAAAGGATAGAGATGGCATATCTAAA
AAATCTGGTGGTGACGATGATTTGCCACATATGCTCTTCGAAGAAGAGCTTTCACAGGTT
GAAGATGTAGCAAGGGCAATCGCCTATAAAAAGCAGCATGAAGTTGATGTAATCTCTTTG
ACTCCAGATATCCAGGAGTCACCACAGGACAATATCGACCCACAAGAACTCCGAAGGATG
CTCCAAGAACTTGCTGACCAGAATTGTTCAATGGGTAACAAGCTTTTCGTTTTTCCAGAG
GCAGTGAAGGCTAATTCGACAATTGATGTATATTTGAATCGTAACCTATCGGCTTTGGCG
AATGAGCCTGATGTCCACATCAAAGGAGCATTCAATAGTTGGAGATGGAGGCCTTTCACC
GAAAGACTGCACAAGAGTGAATTGAGTGGGGATTGGTGGTCTTGCAAACTGCACATACCC
AAGGAAGCTTATAGATTAGACTTTGTGTTCTTCAATGGTCGTTTAGTCTATGATAACAAT
GATAGTAATGATTTTGTGCTGCAAGTAGAAAGTACAATGGATGAAGATTCCTTTGAGGAG
TTCTTGGTTGAAGAAAAGAAAAGAGAACTTGAGAGAGTTGCCACTGAAGAAGCTGAAAGG
AGGAGGCATGCTGAAGAGCAGCAGCGAATGGGAGAACAAAGGGCTGCAGAACAAGCTGCC
AGGGAACAGGCTAAGAAGGAGATAGAGTTGAAGAAGAACAAATTGCAAAATCTGTTGAGT
TCAGCCAGAACACATGTTGATAATTTGTGGCACATAGAGCCTAGCACATATAGACAAGGG
GACACTGTCAGATTGTACTATAACAGAAACTCAAGGCCGCTTATGCATAGTACTGAGATC
TGGATGCATGGTGGTTGCAATAGTTGGACTGATGGACTCTCTATTGTTGAAAGACTTGTC
GAATGTGATGACGAAAATGGTGATTGGTGGTATGCTAATGTTCATATACCTGAAAAGGCC
TTTGTATTGGACTGGGTTTTTGCTGACGGGCCACCTGGAAATGCAAGGAATTATGACAAC
AATGGTCGACAAGATTTTCATGCTATTCTTCCAAATGCCATGACTAACGAAGAATATTGG
GTTGAAGAGGAAAACTGTATCTATACAAGGCTTCTCCACGAGATCAGAGAACGGGAGGAA
GCTATTAAAATAAAGGTTGAGAAAAGAGCAAAAATGAAATCTGAGATGAAGGAAAAGACT
ATGAGAATGTTTCTACTTTCTCAGAAACACATTGTTTATACTGAACCACTTGAAATACGT
GCTGGAACAACTGTGGATGTTCTATATAATCCTTCTAATACGGTGCTGAATGGAAAGCCA
GAGGTTTGGTTTAGGTGGTCCTTTAACCGATGGATGCATCCAAGTGGTGTTTTACCACCC
AAGAAGATGGTGAAAACAGAAGATGGTTGTCACTTAAAAGCGACAGTTAGTGTTCCATCG
GATGCTTATATGATGGACTTTGTTTTCTCTGAGTCGGAAGAAGGTGGAATCTATGACAAC
AGGAATGGGACAGACTATCATATTCCTGTTTCTGGTTCCAATGCAAAGGAGCCTCCCATT
CATATTGTCCATATAGCGGTTGAGATGGCACCCATTGCAAAGGTTGGAGGCCTTGCTGAC
GTTGTCACAAGTCTTTCACGTGCAATTCAAGAGTTAGGCCATCATGTTGAGGTTATTCTC
CCGAAATATAATTTTATGAATCAAAGCAATGTGAAGAATTTGCATGTACGTCAAAGCTTT
TCTTTGGGTGGTACAGAAATTAAAGTGTGGTTTGGACTAGTTGAAGACCTGTCTGTTTAC
TTCTTGGAACCTCAAAATGGGATGTTTGGGGGTGGATGGGTATATGGAGGGAACGATGCT
GGCAGATTTGGCTTGTTCTGTCAGTCTGCTCTAGAGTTCCTCCTTCAGAGTGGATCTTCT
CCACATATAATACACTGCCATGATTGGTCAAGTGCACCAGTTGCCTGGCTATACAAGGAA
CACTATGCAGAATCCAGGTTGGCAACTGCCCGGATTATATTTACCATCCATAATCTTGAG
TTTGGAGCACATTTTATTGGAAAAGCAATGACATACTGCGACAAAGCCACAACTGTTTCT
CACACGTATTCAAAGGAAGTCGCAGGTCATGGTGCCATAGCTCCTCATCGTGGAAAATTC
TATGGAATTCTCAATGGAATTGATCCAGATATCTGGGATCCATATACTGATAACTTCATC
CCGATGCATTATACTTCTGAAAATGTGGTTGAAGGCAAGAATGCTGCAAAGAGAGCATTG
CAGCAGAGGTTTGGACTGCAGCAGACTGATGTCCCCATTGTTGGAATCATCACTCGTCTG
ACAGCCCAGAAGGGTATCCACCTCATTAAACATGCACTTCATCGGACACTTGAACGCAAT
GGACAGGTGGTTTTGCTTGGTTCAGCTCCAGATCCTCGGATACAGAGTGATTTCTGCAGA
TTGGCTGATAGTCTTCATGGTGAAAACCATGGCAGGGTTAGACTATGTTTAACTTATGAC
GAGCCTCTCTCACACCTGATATATGCTGGCTCTGACTTCATCCTTGTTCCATCCATCTTT
GAACCTTGCGGTTTGACTCAACTTGTTGCCATGCGCTATGGATCCATCCCTATTGTTCGG
AAAACCGGAGGACTTTACGACACTGTTTTCGACGTAGACCATGACAAAGACCGGGCTCGA
GTTCTAGGCCTTGAACCAAATGGGTTCAGCTTTGATGGAGCTGACTGTAATGGTGTGGAT
TACGCCCTGAACAGAGCAATCTCTTCTTGGTTTGAAGCCCGCGGTTGGTTCCACTCCCTC
TGCAAAAGGGTCATGGAGCAAGACTGGTCCTGGAACCGGCCTGCCCTGGACTACATTGAA
CTGTACCATTCAGCTCACAAATTTTGA

CDS

5367 bp

>Os08t0191433-02 Starch synthase, Starch biosynthesis, Amylopectin synthesis
ATGGAGATGGCTCTCCGGCCTCAAAGCCTTCTATGCCCTCGGAGCAGGCTGAAGGTCGTC
ATCCGGCCAGCTAGCAGTGCCAGCGGTGGTGGCCTCGCGCAGTATTTCTTAATGACCAGG
AGATATACTGGAAGCAGAATTGTTCGATGCATGGTTTCAAGTTCAGACTGTCCTAATAGG
AAAGCAAAGAGGACGATTTCCCTTCATACGGAAGTCGCTTCTTCTAGGGGATATGCTCCG
AGAATTGCTGCTGAATCAAGTATTCAGGAGCGAGAACATATTAATAGTGATGAAGAAACA
TTTGATACGTACAACAGATTACTACGTAATGAGTCAACAGAGTGGAAAAAGTTAGATACT
ACTGAAGTGGATTTGTCACAAGATGTTTCAAGCAGTTCAATGAGGAAAGTGGATGCGACG
GATGAAGCTAAGCTAGATATACTTGAGGATGATTTGCCCAGAAATTTGTTGAACGGTGTA
ACAATGGGGGAAGTAGATATGTTGGATGAAGCTGGGGCAGAAGATGATGTATTTGAGGTG
GACTTGTCAGCCTTGCATAATTCCACAGTGGGGAAAATGGATGCGGTAAATGAAGTTGGG
ACTGAAAATGACTTATTTGAGGTGGATCTGTCAGCATTGCATAGTGCTGCAGTGGGGAAG
GTGGATGTAGTAGATGGAGCTAAAGCTAAAGAAGATTTGTTTGAGATGGATTCATTAGCA
TTGCACAGTGTTACAATGGGGAAGGTGGATGCAATAAATGCAGCTGGAGCTGAAGGAGAC
AAATTTGAGGTGGATCTGTCTGCGCTCGCGTCGAACAATTCAATGATAGAGGCAGTTAAT
GTGATGGATGAAGCTAAGGCTATAGAAGACACACTCGAGGTGGATTTGTCAGGAAATGCT
ACAAGCAGTTCAACATATGGGGAAGTTAAATTTGAGGTGGATTCATTAGGAAATACTTCA
AGCACTGTAATGTATGGGCCAGCGGATGGAGCGTATGAACCTCGGTCCGATGAAGTCACT
TTTAAGGTGGATTCATCAGAAAATGCGTCAAACAATGTAATGTATGGGAGAGCAGATGTG
GTGGATGAATCTTGGGCTGATGAAGGCATATTTGAGGTGGATTTTTTTACAAATGCTTCA
AGCGGCGCAGAATATGGAAAAGTGGATGTGGTGGATGAAGCTAAAACTGATGATTTCACA
TTTGAGATTGATTCATTAGAAAAAGATTCAAACAATAAAATGCATGGGAAAGCTCATATG
GTGGATGAAGCTTGGGACGATGAAGCCATATTTGAGGTTGATTTGTTTGGAAATGCTTCA
AGCATTCCGATATATGGGGAGGTGAATGTGTTGGATGAAGCTCGGGCTGATGATGGAAAA
TTTGAGGTTGACTTATTAGGGAATACTTCTAGCAATTCAACACATGAGGAAGTGGATGTG
GTAGATGAAGCTCAAACAGGTGAAGCCACATTTGAGGTGGATTTGCTTGGAAATGCTTTA
AGCAGTGCAATATATAAAGAAGTGCCTGTCATGGGTGGAGCTCAGGATGATGAAGTTGAT
GTAGATTTCTCAATAAATGCTTCAATCACCGAAACAGAAAAGGAAGCAGATGCAGTTGAT
GAAGCTAGAGTTGAAGATGAGACATTTGATATGGATTTAGTAGGTAAACAGATATCAATC
GATTCTATGAATGATGATGTAGTTGAAGAAGGGACTAAACATCACAGATATCCAATGTTG
TCTTCAGCATTCATAGAAGTCAAGACCATTCATGAAACACCTGTAAGTTTAAAGCCTGAA
CTTATGTCAGTTGTCATGGATCAGGAACAAGACAAACCAATTTCCAGCGTTTATCAACAA
GAAGGATCAATTTTTAATTTGCATGCAGAAAACCAATCAACGGTAGATTTTCATGAACGG
GAGCAAATGGCTATTACTTTTGATAAACAAAAGGAATCAGTTGCTAAACTCTCTAAAGAA
GACCAACAGACTGCTGGTTTACCTGAGCAAAACATGTCCTTTGATGGTGTCCATAGGAAA
AGCCAGTCAATTATTGGGCTCCCATTTCAACACCAATCAATTGTTAGTTCCCCTGAAAAA
TACCGATCAATTGTGGGTTTTCATGGACAAAATCAATCAATCATCAGCTCTCATAAACAA
GACAAATCAATTGTTGGTGTTCCTAAAAAAATTCAATCCATTGTTGGTTCCACTAAGCAT
GATGATTCAATTGTTGGTTTCCGCAAACAAGACAGATCAATTGTTAGTGTGCCTGAGCAA
AAACAATCAATAGTTGGTTTTCATAAACAAGATCTATCAATTGTTGCTGTCAGCGAACAA
AATCTATCAATTGTTGCTATACCTAGAGAGAGTCAATCAAAGCAAATTTCTATTGTTCGG
AGACATGATCCACTACATTTGAAGGAAGTGGAAACAAAGGATAGAGATGGCATATCTAAA
AAATCTGGTGGTGACGATGATTTGCCACATATGCTCTTCGAAGAAGAGCTTTCACAGGTT
GAAGATGTAGCAAGGGCAATCGCCTATAAAAAGCAGCATGAAGTTGATGTAATCTCTTTG
ACTCCAGATATCCAGGAGTCACCACAGGACAATATCGACCCACAAGAACTCCGAAGGATG
CTCCAAGAACTTGCTGACCAGAATTGTTCAATGGGTAACAAGCTTTTCGTTTTTCCAGAG
GCAGTGAAGGCTAATTCGACAATTGATGTATATTTGAATCGTAACCTATCGGCTTTGGCG
AATGAGCCTGATGTCCACATCAAAGGAGCATTCAATAGTTGGAGATGGAGGCCTTTCACC
GAAAGACTGCACAAGAGTGAATTGAGTGGGGATTGGTGGTCTTGCAAACTGCACATACCC
AAGGAAGCTTATAGATTAGACTTTGTGTTCTTCAATGGTCGTTTAGTCTATGATAACAAT
GATAGTAATGATTTTGTGCTGCAAGTAGAAAGTACAATGGATGAAGATTCCTTTGAGGAG
TTCTTGGTTGAAGAAAAGAAAAGAGAACTTGAGAGAGTTGCCACTGAAGAAGCTGAAAGG
AGGAGGCATGCTGAAGAGCAGCAGCGAATGGGAGAACAAAGGGCTGCAGAACAAGCTGCC
AGGGAACAGGCTAAGAAGGAGATAGAGTTGAAGAAGAACAAATTGCAAAATCTGTTGAGT
TCAGCCAGAACACATGTTGATAATTTGTGGCACATAGAGCCTAGCACATATAGACAAGGG
GACACTGTCAGATTGTACTATAACAGAAACTCAAGGCCGCTTATGCATAGTACTGAGATC
TGGATGCATGGTGGTTGCAATAGTTGGACTGATGGACTCTCTATTGTTGAAAGACTTGTC
GAATGTGATGACGAAAATGGTGATTGGTGGTATGCTAATGTTCATATACCTGAAAAGGCC
TTTGTATTGGACTGGGTTTTTGCTGACGGGCCACCTGGAAATGCAAGGAATTATGACAAC
AATGGTCGACAAGATTTTCATGCTATTCTTCCAAATGCCATGACTAACGAAGAATATTGG
GTTGAAGAGGAAAACTGTATCTATACAAGGCTTCTCCACGAGATCAGAGAACGGGAGGAA
GCTATTAAAATAAAGGTTGAGAAAAGAGCAAAAATGAAATCTGAGATGAAGGAAAAGACT
ATGAGAATGTTTCTACTTTCTCAGAAACACATTGTTTATACTGAACCACTTGAAATACGT
GCTGGAACAACTGTGGATGTTCTATATAATCCTTCTAATACGGTGCTGAATGGAAAGCCA
GAGGTTTGGTTTAGGTGGTCCTTTAACCGATGGATGCATCCAAGTGGTGTTTTACCACCC
AAGAAGATGGTGAAAACAGAAGATGGTTGTCACTTAAAAGCGACAGTTAGTGTTCCATCG
GATGCTTATATGATGGACTTTGTTTTCTCTGAGTCGGAAGAAGGTGGAATCTATGACAAC
AGGAATGGGACAGACTATCATATTCCTGTTTCTGGTTCCAATGCAAAGGAGCCTCCCATT
CATATTGTCCATATAGCGGTTGAGATGGCACCCATTGCAAAGGTTGGAGGCCTTGCTGAC
GTTGTCACAAGTCTTTCACGTGCAATTCAAGAGTTAGGCCATCATGTTGAGGTTATTCTC
CCGAAATATAATTTTATGAATCAAAGCAATGTGAAGAATTTGCATGTACGTCAAAGCTTT
TCTTTGGGTGGTACAGAAATTAAAGTGTGGTTTGGACTAGTTGAAGACCTGTCTGTTTAC
TTCTTGGAACCTCAAAATGGGATGTTTGGGGGTGGATGGGTATATGGAGGGAACGATGCT
GGCAGATTTGGCTTGTTCTGTCAGTCTGCTCTAGAGTTCCTCCTTCAGAGTGGATCTTCT
CCACATATAATACACTGCCATGATTGGTCAAGTGCACCAGTTGCCTGGCTATACAAGGAA
CACTATGCAGAATCCAGGTTGGCAACTGCCCGGATTATATTTACCATCCATAATCTTGAG
TTTGGAGCACATTTTATTGGAAAAGCAATGACATACTGCGACAAAGCCACAACTGTTTCT
CACACGTATTCAAAGGAAGTCGCAGGTCATGGTGCCATAGCTCCTCATCGTGGAAAATTC
TATGGAATTCTCAATGGAATTGATCCAGATATCTGGGATCCATATACTGATAACTTCATC
CCGATGCATTATACTTCTGAAAATGTGGTTGAAGGCAAGAATGCTGCAAAGAGAGCATTG
CAGCAGAGGTTTGGACTGCAGCAGACTGATGTCCCCATTGTTGGAATCATCACTCGTCTG
ACAGCCCAGAAGGGTATCCACCTCATTAAACATGCACTTCATCGGACACTTGAACGCAAT
GGACAGGTGGTTTTGCTTGGTTCAGCTCCAGATCCTCGGATACAGAGTGATTTCTGCAGA
TTGGCTGATAGTCTTCATGGTGAAAACCATGGCAGGGTTAGACTATGTTTAACTTATGAC
GAGCCTCTCTCACACCTGATATATGCTGGCTCTGACTTCATCCTTGTTCCATCCATCTTT
GAACCTTGCGGTTTGACTCAACTTGTTGCCATGCGCTATGGATCCATCCCTATTGTTCGG
AAAACCGGAGGACTTTACGACACTGTTTTCGACGTAGACCATGACAAAGACCGGGCTCGA
GTTCTAGGCCTTGAACCAAATGGGTTCAGCTTTGATGGAGCTGACTGTAATGGTGTGGAT
TACGCCCTGAACAGAGCAATCTCTTCTTGGTTTGAAGCCCGCGGTTGGTTCCACTCCCTC
TGCAAAAGGGTCATGGAGCAAGACTGGTCCTGGAACCGGCCTGCCCTGGACTACATTGAA
CTGTACCATTCAGCTCACAAATTTTGA

Protein

1789 aa

>Os08t0191433-02 Starch synthase, Starch biosynthesis, Amylopectin synthesis
MEMALRPQSLLCPRSRLKVVIRPASSASGGGLAQYFLMTRRYTGSRIVRCMVSSSDCPNR
KAKRTISLHTEVASSRGYAPRIAAESSIQEREHINSDEETFDTYNRLLRNESTEWKKLDT
TEVDLSQDVSSSSMRKVDATDEAKLDILEDDLPRNLLNGVTMGEVDMLDEAGAEDDVFEV
DLSALHNSTVGKMDAVNEVGTENDLFEVDLSALHSAAVGKVDVVDGAKAKEDLFEMDSLA
LHSVTMGKVDAINAAGAEGDKFEVDLSALASNNSMIEAVNVMDEAKAIEDTLEVDLSGNA
TSSSTYGEVKFEVDSLGNTSSTVMYGPADGAYEPRSDEVTFKVDSSENASNNVMYGRADV
VDESWADEGIFEVDFFTNASSGAEYGKVDVVDEAKTDDFTFEIDSLEKDSNNKMHGKAHM
VDEAWDDEAIFEVDLFGNASSIPIYGEVNVLDEARADDGKFEVDLLGNTSSNSTHEEVDV
VDEAQTGEATFEVDLLGNALSSAIYKEVPVMGGAQDDEVDVDFSINASITETEKEADAVD
EARVEDETFDMDLVGKQISIDSMNDDVVEEGTKHHRYPMLSSAFIEVKTIHETPVSLKPE
LMSVVMDQEQDKPISSVYQQEGSIFNLHAENQSTVDFHEREQMAITFDKQKESVAKLSKE
DQQTAGLPEQNMSFDGVHRKSQSIIGLPFQHQSIVSSPEKYRSIVGFHGQNQSIISSHKQ
DKSIVGVPKKIQSIVGSTKHDDSIVGFRKQDRSIVSVPEQKQSIVGFHKQDLSIVAVSEQ
NLSIVAIPRESQSKQISIVRRHDPLHLKEVETKDRDGISKKSGGDDDLPHMLFEEELSQV
EDVARAIAYKKQHEVDVISLTPDIQESPQDNIDPQELRRMLQELADQNCSMGNKLFVFPE
AVKANSTIDVYLNRNLSALANEPDVHIKGAFNSWRWRPFTERLHKSELSGDWWSCKLHIP
KEAYRLDFVFFNGRLVYDNNDSNDFVLQVESTMDEDSFEEFLVEEKKRELERVATEEAER
RRHAEEQQRMGEQRAAEQAAREQAKKEIELKKNKLQNLLSSARTHVDNLWHIEPSTYRQG
DTVRLYYNRNSRPLMHSTEIWMHGGCNSWTDGLSIVERLVECDDENGDWWYANVHIPEKA
FVLDWVFADGPPGNARNYDNNGRQDFHAILPNAMTNEEYWVEEENCIYTRLLHEIREREE
AIKIKVEKRAKMKSEMKEKTMRMFLLSQKHIVYTEPLEIRAGTTVDVLYNPSNTVLNGKP
EVWFRWSFNRWMHPSGVLPPKKMVKTEDGCHLKATVSVPSDAYMMDFVFSESEEGGIYDN
RNGTDYHIPVSGSNAKEPPIHIVHIAVEMAPIAKVGGLADVVTSLSRAIQELGHHVEVIL
PKYNFMNQSNVKNLHVRQSFSLGGTEIKVWFGLVEDLSVYFLEPQNGMFGGGWVYGGNDA
GRFGLFCQSALEFLLQSGSSPHIIHCHDWSSAPVAWLYKEHYAESRLATARIIFTIHNLE
FGAHFIGKAMTYCDKATTVSHTYSKEVAGHGAIAPHRGKFYGILNGIDPDIWDPYTDNFI
PMHYTSENVVEGKNAAKRALQQRFGLQQTDVPIVGIITRLTAQKGIHLIKHALHRTLERN
GQVVLLGSAPDPRIQSDFCRLADSLHGENHGRVRLCLTYDEPLSHLIYAGSDFILVPSIF
EPCGLTQLVAMRYGSIPIVRKTGGLYDTVFDVDHDKDRARVLGLEPNGFSFDGADCNGVD
YALNRAISSWFEARGWFHSLCKRVMEQDWSWNRPALDYIELYHSAHKF*

CDS

chr08:5352105..5352206 (+ strand) : 102 bp

chr08:5353152..5353215 (+ strand) : 64 bp

chr08:5353302..5356535 (+ strand) : 3234 bp

chr08:5356719..5356933 (+ strand) : 215 bp

chr08:5357467..5357737 (+ strand) : 271 bp

chr08:5358330..5358505 (+ strand) : 176 bp

chr08:5358631..5358738 (+ strand) : 108 bp

chr08:5359165..5359274 (+ strand) : 110 bp

chr08:5360635..5360737 (+ strand) : 103 bp

chr08:5361002..5361172 (+ strand) : 171 bp

chr08:5361296..5361424 (+ strand) : 129 bp

chr08:5361666..5361848 (+ strand) : 183 bp

chr08:5361956..5362087 (+ strand) : 132 bp

chr08:5362167..5362278 (+ strand) : 112 bp

chr08:5362444..5362567 (+ strand) : 124 bp

chr08:5362796..5362928 (+ strand) : 133 bp

FASTA

>Os08t0191433-02 class=Sequence position=chr08:5352105..5362928 (+ strand)
ATGGAGATGG CTCTCCGGCC TCAAAGCCTT CTATGCCCTC GGAGCAGGCT GAAGGTCGTC ATCCGGCCAG CTAGCAGTGC
CAGCGGTGGT GGCCTCGCGC AGGTATGATT CAGTTTCAAG AAGTTCATGA TTCCGGCTGC TCTTGCTTTT CTTGATTTGC
TTGATCCACC AAGTGTTCGT CCTTCTGAAG GGGCATGCAA GATTATTTAC TCAGTTACAT GATCTCAAAT ATTAATATTT
TGGTTGTGTT TCCTGTGGTT TTGATTCATT TCATCTTGGG AACATACTCT GGTGATGAAG GGGAAATTCA TGTTATGGGG
AGTTCTTTCC TGGACTTTCT TACGGTTGTT GATAGATTTG ATTGAAATAT TTTGGGAAAT ATTTCTGTGG TCAATGATCT
TAATTCTCAA ATTTAGATTA GGTTAAAACA ACGGGACTGA AAGTTCCTTT CTGGAGATCG AAAGGTAGTT AATTCTACTC
CATTTGTTAA AATTTCCCCC CAAGTACTTG TATATTTAGG TCTGCATAAT CATTGAAAGA TTTCCTCATC TGGGCTAATT
CTGTTCAGTT TTGAAGTGAA GCCTAAAAGA CCTTGTCCTC TTGTTTTGAT TTGTTGGGTT CTTGTTTTGT AAGGAAAAAT
ACCGCTCATT ATGCACCCCC TTTTTTATCT ACAGTTGAAC ATTATGCATT TACATTAATG TGAGAGGGTA TCATCCATTC
TAAACCGACA TGCTAAGAAA TATGGTTTCG GAGTGCAATT CAGTATAATT TTTTAAATAT TTTTCTGACA GGAATTCTTT
CAATAATTTT ATATTGAGGA TCTGAGAGGC ATAGATTTTT TATAGTAAAA TAACCTACAT ATTTCAAAAC AGCAATATTG
ATTCAAATAA TTCAATACTC CCTCCGTCCC TTTATAATTG TCGTTTGGGA GTTGTGCCCC CCTCACAAGC ACAGATTCCT
AGCGACTAAT AAAAGGGGAC AGAGGGAGTA AGTTCTTTTT ATTGAAACAT CTCGAGCTAC AATATTTACT TTCTTTTCTT
TTTCCAGTAT TTCTTAATGA CCAGGAGATA TACTGGAAGC AGAATTGTTC GATGCATGGT TTCAAGTTCA GGTTTGTGTA
GGATAGCTTC GTAAAAGCTT TATTAATTTT CTTATTTGCT ATGCTAAGGT CATGTTTGTT AAAATTATAT CATGCAGACT
GTCCTAATAG GAAAGCAAAG AGGACGATTT CCCTTCATAC GGAAGTCGCT TCTTCTAGGG GATATGCTCC GAGAATTGCT
GCTGAATCAA GTATTCAGGA GCGAGAACAT ATTAATAGTG ATGAAGAAAC ATTTGATACG TACAACAGAT TACTACGTAA
TGAGTCAACA GAGTGGAAAA AGTTAGATAC TACTGAAGTG GATTTGTCAC AAGATGTTTC AAGCAGTTCA ATGAGGAAAG
TGGATGCGAC GGATGAAGCT AAGCTAGATA TACTTGAGGA TGATTTGCCC AGAAATTTGT TGAACGGTGT AACAATGGGG
GAAGTAGATA TGTTGGATGA AGCTGGGGCA GAAGATGATG TATTTGAGGT GGACTTGTCA GCCTTGCATA ATTCCACAGT
GGGGAAAATG GATGCGGTAA ATGAAGTTGG GACTGAAAAT GACTTATTTG AGGTGGATCT GTCAGCATTG CATAGTGCTG
CAGTGGGGAA GGTGGATGTA GTAGATGGAG CTAAAGCTAA AGAAGATTTG TTTGAGATGG ATTCATTAGC ATTGCACAGT
GTTACAATGG GGAAGGTGGA TGCAATAAAT GCAGCTGGAG CTGAAGGAGA CAAATTTGAG GTGGATCTGT CTGCGCTCGC
GTCGAACAAT TCAATGATAG AGGCAGTTAA TGTGATGGAT GAAGCTAAGG CTATAGAAGA CACACTCGAG GTGGATTTGT
CAGGAAATGC TACAAGCAGT TCAACATATG GGGAAGTTAA ATTTGAGGTG GATTCATTAG GAAATACTTC AAGCACTGTA
ATGTATGGGC CAGCGGATGG AGCGTATGAA CCTCGGTCCG ATGAAGTCAC TTTTAAGGTG GATTCATCAG AAAATGCGTC
AAACAATGTA ATGTATGGGA GAGCAGATGT GGTGGATGAA TCTTGGGCTG ATGAAGGCAT ATTTGAGGTG GATTTTTTTA
CAAATGCTTC AAGCGGCGCA GAATATGGAA AAGTGGATGT GGTGGATGAA GCTAAAACTG ATGATTTCAC ATTTGAGATT
GATTCATTAG AAAAAGATTC AAACAATAAA ATGCATGGGA AAGCTCATAT GGTGGATGAA GCTTGGGACG ATGAAGCCAT
ATTTGAGGTT GATTTGTTTG GAAATGCTTC AAGCATTCCG ATATATGGGG AGGTGAATGT GTTGGATGAA GCTCGGGCTG
ATGATGGAAA ATTTGAGGTT GACTTATTAG GGAATACTTC TAGCAATTCA ACACATGAGG AAGTGGATGT GGTAGATGAA
GCTCAAACAG GTGAAGCCAC ATTTGAGGTG GATTTGCTTG GAAATGCTTT AAGCAGTGCA ATATATAAAG AAGTGCCTGT
CATGGGTGGA GCTCAGGATG ATGAAGTTGA TGTAGATTTC TCAATAAATG CTTCAATCAC CGAAACAGAA AAGGAAGCAG
ATGCAGTTGA TGAAGCTAGA GTTGAAGATG AGACATTTGA TATGGATTTA GTAGGTAAAC AGATATCAAT CGATTCTATG
AATGATGATG TAGTTGAAGA AGGGACTAAA CATCACAGAT ATCCAATGTT GTCTTCAGCA TTCATAGAAG TCAAGACCAT
TCATGAAACA CCTGTAAGTT TAAAGCCTGA ACTTATGTCA GTTGTCATGG ATCAGGAACA AGACAAACCA ATTTCCAGCG
TTTATCAACA AGAAGGATCA ATTTTTAATT TGCATGCAGA AAACCAATCA ACGGTAGATT TTCATGAACG GGAGCAAATG
GCTATTACTT TTGATAAACA AAAGGAATCA GTTGCTAAAC TCTCTAAAGA AGACCAACAG ACTGCTGGTT TACCTGAGCA
AAACATGTCC TTTGATGGTG TCCATAGGAA AAGCCAGTCA ATTATTGGGC TCCCATTTCA ACACCAATCA ATTGTTAGTT
CCCCTGAAAA ATACCGATCA ATTGTGGGTT TTCATGGACA AAATCAATCA ATCATCAGCT CTCATAAACA AGACAAATCA
ATTGTTGGTG TTCCTAAAAA AATTCAATCC ATTGTTGGTT CCACTAAGCA TGATGATTCA ATTGTTGGTT TCCGCAAACA
AGACAGATCA ATTGTTAGTG TGCCTGAGCA AAAACAATCA ATAGTTGGTT TTCATAAACA AGATCTATCA ATTGTTGCTG
TCAGCGAACA AAATCTATCA ATTGTTGCTA TACCTAGAGA GAGTCAATCA AAGCAAATTT CTATTGTTCG GAGACATGAT
CCACTACATT TGAAGGAAGT GGAAACAAAG GATAGAGATG GCATATCTAA AAAATCTGGT GGTGACGATG ATTTGCCACA
TATGCTCTTC GAAGAAGAGC TTTCACAGGT TGAAGATGTA GCAAGGGCAA TCGCCTATAA AAAGCAGCAT GAAGTTGATG
TAATCTCTTT GACTCCAGAT ATCCAGGAGT CACCACAGGA CAATATCGAC CCACAAGAAC TCCGAAGGAT GCTCCAAGAA
CTTGCTGACC AGAATTGTTC AATGGGTAAC AAGCTTTTCG TTTTTCCAGA GGCAGTGAAG GCTAATTCGA CAATTGATGT
ATATTTGAAT CGTAACCTAT CGGCTTTGGC GAATGAGCCT GATGTCCACA TCAAAGGAGC ATTCAATAGT TGGAGATGGA
GGCCTTTCAC CGAAAGACTG CACAAGAGTG AATTGAGTGG GGATTGGTGG TCTTGCAAAC TGCACATACC CAAGGAAGCT
TATAGATTAG ACTTTGTGTT CTTCAATGGT CGTTTAGTCT ATGATAACAA TGATAGTAAT GATTTTGTGC TGCAAGTAGA
AAGTACAATG GATGAAGATT CCTTTGAGGA GTTCTTGGTT GAAGAAAAGA AAAGAGAACT TGAGAGAGTT GCCACTGAAG
AAGCTGAAAG GAGGAGGCAT GCTGAAGAGC AGCAGCGAAT GGGAGAACAA AGGGCTGCAG AACAAGCTGC CAGGGAACAG
GCTAAGAAGG AGATAGAGTT GAAGAAGAAC AAATTGCAAA ATCTGTTGAG TTCAGCCAGA ACACATGTTG ATAATTTGTG
GCACATAGAG CCTAGCACAT ATAGACAAGG GGACACTGTC AGATTGTACT ATAACAGAAA CTCAAGGCCG CTTATGCATA
GTACTGAGAT CTGGATGCAT GGTGGTTGCA ATAGTTGGAC TGATGGACTC TCTATTGTTG AAAGACTTGT CGAATGTGAT
GACGAAAATG GTGATTGGTG GTATGCTAAT GGTATGATAT TACACATTTT TCTCTTACTT GGGTAGGAGT ATATTAGAGC
ATCATAAGAT ACATTACCAC ATTAGCGTAG GGCTTCTAGA AAAAAAAATC CTTGTTCTAG TTATCTTGCA CTCTTATTTT
TTTGGTTTAC TTGGGTAAGA ATATATGTAA TGCATTGCTT TTCGTTTTAA ACAGTTCATA TACCTGAAAA GGCCTTTGTA
TTGGACTGGG TTTTTGCTGA CGGGCCACCT GGAAATGCAA GGAATTATGA CAACAATGGT CGACAAGATT TTCATGCTAT
TCTTCCAAAT GCCATGACTA ACGAAGAATA TTGGGTTGAA GAGGAAAACT GTATCTATAC AAGGCTTCTC CACGAGATCA
GAGAACGGGA GGAAGCTATT AAAATAAAGG TCAGTCAAAA TAGAATCTTT AAATATGGAC TTGGTTATTT GATCCAGAGT
TTTACAACAT GGTTCTGATG TATTTTGTTG GCTGACGAAT TCTCTTGCAA TTGTTCTATT TGTAATTAAC TTGCGTAGAG
CTAATGAACT TCACATGTGA AATCAGGTTT TTGACCAACC GATTACCTTC TTTTTTTTTG TGGGGATGTT TTTGACCAAA
TAAGTTACTA TTTCACATCC TAAGACATGT TATAAAATTC ATCCAAACTC AGTATTCTTT CAAATATACA ATAATTAATT
TGACCAGTTA GATCATTCTT CACTTTGAAC TTGTGCCTTA AGCTGACTGT TTTGACCAAA CGAATTGATG GCCCACCCAG
TTAGCAGTTA GCACTATTTA TTGGAACTTC TGTTATACCA TATTATATTA TTCAAGGAAA AATGTAGTTG TTCACTGTCA
TGTATATATC TTGATGTTTT GAACATCAGA TATATGTTGT GAAGTCCTTC GGCTTACTAT TCCCACTTTT TTGCTTGTAC
AGGTTGAGAA AAGAGCAAAA ATGAAATCTG AGATGAAGGA AAAGACTATG AGAATGTTTC TACTTTCTCA GAAACACATT
GTTTATACTG AACCACTTGA AATACGTGCT GGAACAACTG TGGATGTTCT ATATAATCCT TCTAATACGG TGCTGAATGG
AAAGCCAGAG GTTTGGTTTA GGTGGTCCTT TAACCGATGG ATGCATCCAA GTGGTGTTTT ACCACCCAAG AAGATGGTGA
AAACAGAAGA TGGTTGTCAC TTAAAAGCGA CAGGTTTGAG CTTGACTTGT TACATTGTTC CTTTTAATGC TGATAGATTT
ATATGATACA TGTACTGATG TGCACTTTTA TCCATTAATA TATATTATTA AGTGCTACTG GACCATTAAT TGATCAAGCA
CTGTTGAAGT ATATGTCTAG CAATGTTCCA ACTTTGATCC ATAAATGGTA TCTAGTACCA ATTTTGAAAC CTGAATCACA
AGGTGACATA ATTATACTAT TCTGAAGAGC TAGCTAGTTT AGTGCCTAAA TGAGCTACGA CAATTCTGTA ACTGGAGTTT
TCTAAATGTT ATAACTGCAA AAAATCTAGC TGGTTTACTG TAGACATAAT TCATTATAAT ATCTAGTATA TCGCAGTCTA
ACCCAGAAGA GCTCAAAATT TCAAACTACT TTGGATTATT ACTCAACTCT TGGTAAAAGG TGGCAATTTG GTGATTAAAC
TCAATAATGT CCTGTCAAAA TTTACCTTTT ATGTTTAACT TATTTTGGAA CTTTGGTTGG TATATCGTTC AGTTTACTCA
ATATTACAGT GTAATACATT TTTTCCCTTC CATATTCATT AGTCCCTGTT ATGTTCCTTC TCCAGTTAGT GTTCCATCGG
ATGCTTATAT GATGGACTTT GTTTTCTCTG AGTCGGAAGA AGGTGGAATC TATGACAACA GGAATGGGAC AGACTATCAT
ATTCCTGTTT CTGGTTCCAA TGCAAAGGAG CCTCCCATTC ATATTGTCCA TATAGCGGTT GAGATGGCAC CCATTGCAAA
GGTAAGCCAT ATTACCATGT AAAATTTTCT GTGGCTAGCA ACAGTGCTAG ACATCAACAC TTGCCAAGTT ATCTGTTATT
TCTATGTGCA TAAAGTAATG CCATACTCTG TAATCTCCAA TTACAGGTTG GAGGCCTTGC TGACGTTGTC ACAAGTCTTT
CACGTGCAAT TCAAGAGTTA GGCCATCATG TTGAGGTTAT TCTCCCGAAA TATAATTTTA TGAATCAAAG CAATGTAAGT
TCAAGTAGCA CAACAGCCTA TGTTTCTCCT ATTATATAAT ATATTATTTA TTTATTTTCG GTTTCTGTGG TGGTTTTGTC
GCTAAGAAAC TCAAATCGAA GAGCTCTCTA TTTTAAGAGA GTCTATTACG ATACTGTATA TGGATGTGCT CCGTGTTGTC
CTTCCTTTCT CAGTTAGTTA GGATTTGTGT TAGATATGTG GATTGCTGTC AAATATTCGA AATGTACCTT AATATATCAT
ATACAATTCT AGTTCTAAAT TTTGTATTAT TTGAAAAAAA ATAACTTTTT CATGTCTTGT CCTTGATGCA CAAGAACTAT
GGAGGCAAAG AGGACTTGTC AAGTGTAGCA GAGAACTCAA GAATATAGAA AAGTGGATTT TATATCTTGT ATGAACCATG
TTTCATCCGT TTCAATGCAG GTGAAGAATT TGCATGTACG TCAAAGCTTT TCTTTGGGTG GTACAGAAAT TAAAGTGTGG
TTTGGACTAG TTGAAGACCT GTCTGTTTAC TTCTTGGAAC CTCAAAATGG GTATGTTGCA TCTCATTCTT CACACAAACA
TAGCTATTAG TCTATTACTC TTGTTTCACG AAAACCATCA TCCCTAATCC TTATACTAGC TAATGCACAG TTCACTAAGC
CTAAGATGCA GGGTATGATA TCCTTCTAAA AACCAATTGT TGGTTCCTGT CGAGTACAAG AGCTAACTTA Gtactccctc
tgttttttaa tagatgacgc cgttgacttt ttctcacatg tttgaccatt cgtcttattc aaaaatttta tgcaaatgta
tacgatataa atcacactta aagaactatg agtgataaaa caactcataa caaaataaat tataattccg taaatatttt
gaataagacg aatggtcaaa catgtgagaa agtcaacggc gtcatctatt aaaaaacgga ggtagtaCCA GTTATTCAAA
CCTTGGCCAG TTTAGGCCCT TCTTTTGATC CCTCCTTCCA CTGCAGTATG CATATTATTA TTTTTTTTCA AGTATGTGAT
ACAAATCTGA AATCTAAATA TAAGAATTAA AGGTACAATC ACCAAATGCA ACCCACCAGA AGTATAATGA TTTCGATTTT
TTTTTTCATT TTTAGTCTTC AATATCATTC TCTTTCTTTG TTTCCATGTT TTGCCTCAGC TGGTAGTCTG AGCAGAATAG
TTCTGTTCTA AGCTTAGATT GCAAAATTGT TTTTGAGAAT CCATGTAATG TGTTTTGCCG CTCCTTAGCA TGGATGGTGG
TTTAAATCTT TTCCCTTAAT ACGAAGATAT GCAAATCTTT TTCTTAGTTT GGGTCGCAAA ATTGTTTGTG ATTTTTTTGA
GAATGTTATG CACTGATCAT GATTCTACTT CAGTTATTAG AATTGGTATC TTTAGTCCTC TAACCTTGAC CAAACAATTG
TGACCTATTC AGCTCTTTGA CTAGGCATAA GGACCTAGCC AGGGTTAAAG AGTTTGCTGG TTCGAGCTCA AATCAGGATA
TCTGAGAACA ACCTGGCCTT GCCCTTTCTC AGCCTATATT GGCCTTTACT GGGAACACAA ATTGCTTGGG TAGCATTAGT
ATTTAGCTAG TTTATATTTA TTTCGATTTT TGCTCTACCA TATCCATGAA CTGCAAGTTC TCTACACAAC TTCATGGCGC
TGAATTGACA GAAGAACATT TGTAAGATGC ACCAGGGCTT AGGTGATTAC ACCACACTGT ACTATAATTC ATACACATGC
TAGTATAATT ATTTACTCCT GACTGGTTCA GTTCCTGTAT GATGATTTCA GTTATCGCAG GAACTGTTTT GGAGATTGTT
TCCTTGTAGG TGGCTTCACA GAATAATCAA TTTGGCATGT CTTGTGGCAG GATGTTTGGG GGTGGATGGG TATATGGAGG
GAACGATGCT GGCAGATTTG GCTTGTTCTG TCAGTCTGCT CTAGAGTTCC TCCTTCAGAG TGGATCTTCT CCAGTAAGTA
TTTCTCTAAT TGAAAACTTC CAAGTCCAAA ATCAGTGATA AAAGAGAATT TTTTACTTTT GGTAATAAAT ATATTGTTTT
TTCCTCTTGA TATTTTCTTC ACGTTCTTGT TTTCCATGCT TGCATTTCAT TATGTCAAAA CATGTTTAAG TCACTGACTT
ATTTGCTGCA TTAGCCTTTT CTTTCCCAGT CACTTTTTCA CCTTACATTC ACTTTACTCC TCTTTTCAAA AAGAGTGACA
TTTTATCGTC CTGACAGCAT ATAATACACT GCCATGATTG GTCAAGTGCA CCAGTTGCCT GGCTATACAA GGAACACTAT
GCAGAATCCA GGTTGGCAAC TGCCCGGATT ATATTTACCA TCCATAATCT TGAGTTTGGA GCACATTTTA TTGGAAAAGC
AATGACATAC TGCGACAAAG CCACAACTGT GAGTGCCTGA TTGTCTTGAA GAGTTTTATC ATCTAGTTTG GTGCATTTTC
ATGTTATATG AAAAATAAAA TTATTTTCAT ATGTTCAAAC ATCTTCATGT CTGTCTTGCC ATACCTTGCA GGTTTCTCAC
ACGTATTCAA AGGAAGTCGC AGGTCATGGT GCCATAGCTC CTCATCGTGG AAAATTCTAT GGAATTCTCA ATGGAATTGA
TCCAGATATC TGGGATCCAT ATACTGATAA CTTCATCCCG GTATAGTCAT GATAGTCGAA TACATTTTTA TACAACTACC
AGTCCATATG TATTTGATCT TGGTAAACTA AAACAAAGTT TGCTTGGGTT GCCAATTATG CGCACTCATA AGATTATCAC
TTTAACTAAT ACTTTTGTGA TAGTTGTCCT AATATGTAAT TATTGAAAGT GCAAATGCAC ACTGATGCCA CAGTATTGCC
CCAAACATTT TTCATGTTTT GCTTATTTCA TCCTATGTCA GATGCATTAT ACTTCTGAAA ATGTGGTTGA AGGCAAGAAT
GCTGCAAAGA GAGCATTGCA GCAGAGGTTT GGACTGCAGC AGACTGATGT CCCCATTGTT GGAATCATCA CTCGTCTGAC
AGCCCAGAAG GGTATCCACC TCATTAAACA TGCACTTCAT CGGACACTTG AACGCAATGG ACAGGTTAAT CATTTGATGA
CAATCTTCTA GTGTCTCCCT AGAACTTGCT TTTCCCTTTC GCAATTATTT TTGCCGACCT ATCTGAAACA AGTGATGTGT
TTGCTTTTTA GGTGGTTTTG CTTGGTTCAG CTCCAGATCC TCGGATACAG AGTGATTTCT GCAGATTGGC TGATAGTCTT
CATGGTGAAA ACCATGGCAG GGTTAGACTA TGTTTAACTT ATGACGAGCC TCTCTCACAC CTGGTCAGTT CCAATATCCT
ACACCATCAA ATTGGTCTAA AAAAATTGTT GCTGGCTAAT AATTTCAGTG ATTCTGCTAC AGATATATGC TGGCTCTGAC
TTCATCCTTG TTCCATCCAT CTTTGAACCT TGCGGTTTGA CTCAACTTGT TGCCATGCGC TATGGATCCA TCCCTATTGT
TCGGAAAACC GGAGGTGAGT GTACATAATA ACATGTACAT ATATGAGCTT TCTTACTGAC CTCAAGGACC ATAAAAATGC
TTTACATACA TAGATAGCTT ACTGGTACTC CTATGATTCA TTCTCTCCTT TCTTTGCACA TCATGAGCTG AACGTGAATC
CTATTTTCTT CACGCGCAGG ACTTTACGAC ACTGTTTTCG ACGTAGACCA TGACAAAGAC CGGGCTCGAG TTCTAGGCCT
TGAACCAAAT GGGTTCAGCT TTGATGGAGC TGACTGTAAT GGTGTGGATT ACGCCCTGAA CAGGCAAGTA CCTCCACACC
TCACAATTGT GTGAATGCAC AATTGAGCTG AACATAATCG TACAGAACCC CGAGCCAAAT TCATCATGTG ACATCCGTGT
GGTTTGTGTG CTTGGTGGTC TATTGTTTAT GTGTCTTCCA TGTAATCGCA AACAAAAAAA GAAGAAGAAT TATCTTCCCT
AATTCAATCA TATATTATCT TATTCATGCA ATGTTTGCTA CCCTTTTGCA GAGCAATCTC TTCTTGGTTT GAAGCCCGCG
GTTGGTTCCA CTCCCTCTGC AAAAGGGTCA TGGAGCAAGA CTGGTCCTGG AACCGGCCTG CCCTGGACTA CATTGAACTG
TACCATTCAG CTCACAAATT TTGA