Os08t0196700-01

Locus

Os08g0196700

Description

HAP2 subunit of HAP complex, Nuclear Factor Y (NF-YA) transcription factor, Drought stress tolerance

RAP-DB Gene Symbol Synonym(s)

HAP2A, OsHAP2A, NF-YA, CBF-B, NF-YA7, OsNF-YA7

RAP-DB Gene Name Synonym(s)

HAP2 SUBUNIT OF CCAAT-BOX BINDING COMPLEX, NUCLEAR FACTOR-Y subunit A7, NUCLEAR FACTOR-Y subunit NF-YA7, NF-YA transcription factor 7

CGSNL Gene Symbol

HAP2A

CGSNL Gene Name

HAP2 SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP2A, NF-YA, CBF-B, NF-YA7, OsNF-YA7, NFYA7

Oryzabase Gene Name Synonym(s)

NUCLEAR FACTOR-Y subunit A7, NUCLEAR FACTOR-Y subunit NF-YA7, NF-YA transcription factor 7, NF-YA subunit 7, NF-YA family 7

Transcript Evidence

AK059903

AB288027

Protein Evidence

Q6Z065

Literature

PMID: 26706071

PMID: 18193457

Note

Manual Curation

June 9, 2016

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: transcription factor activity, sequence-specific DNA binding (GO:0003700)

Functional domain (InterPro)

Nuclear transcription factor Y subunit A (IPR001289)

Full-length cDNA

006-208-G09 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0196700-01)

RiceXPro (AK059903)

Others

Oryzabase (8473)

KEGG (Os08t0196700-01)

Transcript

927 bp

>Os08t0196700-01 HAP2 subunit of HAP complex, Nuclear Factor Y (NF-YA) transcription factor, Drought stress tolerance
ATCTTCGAGAGATTCCTCCCAATCCCGAGCAGAATCCCCCGCCCCGGCGAATCCGCGCGG
CGCTCGAGTGAATTTGACTAGCTAGTAGCCACGCATGAAGCCAGATGGTGAAACTCAGCT
TCGTCCTACAGCTGCTGGACATCCAGATCCTGGTTTGGGCACATCATCTGCAGAATACGT
GGCCTCTCTAGGACCAGCTACAGCTCCAGTATCTTATCCATATATCAGTACCTATTATGG
AGGCACTTATGGTGCTTATAGTGGACAACCTCTGGTTAACGCTGCTTTAATGGCAATGCC
TCCGCATTCTGTGCCCTTGGTGACCGATGCTGTTGTAGAGCCCATATATGTCAATGCAAG
GCAGTATCATGGTATATTAAGGCGGCGCCAATCTCGTGCAAAAGCTGAATCAGAAAATAA
GGCCAACAAAATCCGCAAGCCTTACCTACATGAGTCCCGCCATCTGCATGCTTTGAAAAG
GGCAAGGGGGTCCGGTGGTCGATTTCTCAACTCTAAGGCTGTGGAGGGGAAGCAAGACAC
TAAATCTGTAGATAAAAAGGATGGAGCTGTGCCATCTGAGGAGAAGAGAGACAAGAAGTT
GGCAAATAGCATTATCAAATTGGAGAACTCGAGCCCAACAACACAACCAGGTGCAGATGC
GTCCGATGTTGTATGATGCAAATTTAGCCAATCCCTCCCTAATCCAACCAAATTGCCAGA
ATCGATCGAATTGTGTGCTTGCTTTCTGTTCGTGACAGTTTAAGTCTGTACATAGCTGTT
AGTTTTGATGATTGGATAAATCCATGATAGTATAGTGAACATGTTGTGGGAGCAGTTCAG
TGCTAGGGTTTGTTGCTGAGTGTAGATTATGAACCTTGTGTCACTGTTGTGTTTTGCTTC
TGTTAATGAATGGTAGCTTACAATGGG

CDS

582 bp

>Os08t0196700-01 HAP2 subunit of HAP complex, Nuclear Factor Y (NF-YA) transcription factor, Drought stress tolerance
ATGAAGCCAGATGGTGAAACTCAGCTTCGTCCTACAGCTGCTGGACATCCAGATCCTGGT
TTGGGCACATCATCTGCAGAATACGTGGCCTCTCTAGGACCAGCTACAGCTCCAGTATCT
TATCCATATATCAGTACCTATTATGGAGGCACTTATGGTGCTTATAGTGGACAACCTCTG
GTTAACGCTGCTTTAATGGCAATGCCTCCGCATTCTGTGCCCTTGGTGACCGATGCTGTT
GTAGAGCCCATATATGTCAATGCAAGGCAGTATCATGGTATATTAAGGCGGCGCCAATCT
CGTGCAAAAGCTGAATCAGAAAATAAGGCCAACAAAATCCGCAAGCCTTACCTACATGAG
TCCCGCCATCTGCATGCTTTGAAAAGGGCAAGGGGGTCCGGTGGTCGATTTCTCAACTCT
AAGGCTGTGGAGGGGAAGCAAGACACTAAATCTGTAGATAAAAAGGATGGAGCTGTGCCA
TCTGAGGAGAAGAGAGACAAGAAGTTGGCAAATAGCATTATCAAATTGGAGAACTCGAGC
CCAACAACACAACCAGGTGCAGATGCGTCCGATGTTGTATGA

Protein

194 aa

>Os08t0196700-01 HAP2 subunit of HAP complex, Nuclear Factor Y (NF-YA) transcription factor, Drought stress tolerance
MKPDGETQLRPTAAGHPDPGLGTSSAEYVASLGPATAPVSYPYISTYYGGTYGAYSGQPL
VNAALMAMPPHSVPLVTDAVVEPIYVNARQYHGILRRRQSRAKAESENKANKIRKPYLHE
SRHLHALKRARGSGGRFLNSKAVEGKQDTKSVDKKDGAVPSEEKRDKKLANSIIKLENSS
PTTQPGADASDVV*

5'UTR

chr08:5597606..5597673 (+ strand) : 68 bp

chr08:5598704..5598729 (+ strand) : 26 bp

CDS

chr08:5598730..5598837 (+ strand) : 108 bp

chr08:5599080..5599151 (+ strand) : 72 bp

chr08:5599226..5599390 (+ strand) : 165 bp

chr08:5600562..5600798 (+ strand) : 237 bp

3'UTR

chr08:5600799..5601049 (+ strand) : 251 bp

FASTA

>Os08t0196700-01 class=Sequence position=chr08:5597606..5601049 (+ strand)
ATCTTCGAGA GATTCCTCCC AATCCCGAGC AGAATCCCCC GCCCCGGCGA ATCCGCGCGG CGCTCGAGGT AATCCAATCC
CTCCTCTTCC TCCGCCCTCC CCCTCCCTCG CCGCGTCGGC TCGCCGGACG GACGGTGGGT TCTCCATGGT GTCGGCTTTC
TTTGTGGGCT CTGCCGATTT CCGCGTTCCT GAGGCCGCGT AGAATCTGCA TAGGAGTTGT TTGGGTAGAT TTAGTTGGCG
GAATCCCCCG CGGTGTGTGG AATGGAGGTG GATTAGCTTG GCTCGGTTCG GTCCCATGCG TGGATATGCT GGGCCGCCTT
TGGAGCATTT CTTTGTGGTG TGGCTACCCA GCTGTATAAT AAACATGGCG AGTAGGATTA CTTCCTGTGT AGTCAATTTA
GCCATTCCAT TTAGGGATTT CTGATTCTGT TGCAGGTGTC CGTGGCACTG GTGGTACCTT GATAGAGACT AGAGTGAATG
CCTTTTTCTT TGTTCTGTTT CATTGTTTGC TGCATCCTGA TGCAAATTAG CTCGGCCTGT AAACTGTAAA GGTTGCTTGT
TTGTGTCGTC GAGATGGGAT TTAGTGCGCC GCGGCAGTTT GATGATGAAT TAGGGCCTTA GCAGGTTCTT TGGTTAGGAG
AATGTTAATC CAGGGTGAAG AGCGAAGAAG AACAAGTAGC TCATTAAGCT GCAATTCATG GTATTCATGA AAAGTTGAAA
CGATATGTAT TTCGTTTGTA ATTCATTTCC ACAGCTTTTC TGTTAAAAAA GACATTGAGG TGTGTTTGTT ATTCAAGTAG
TGGAACCACG TATGGAGTTT TCTGGAATGG GAAAAAATCC TAATGGAGCA ATACTGTGTG GAGGTCGAGT CTTTACCGAT
ACTTGTCACA AAATAATTTA GTTATTAGCT CTCTTTTATG AAAGGTAGAA GAATGGTTGT GAATAACTGG GAATGGTTGA
GGAGGATCTG TTTGTCTATT GTGTACTTTT GTGCACTTTG GGGCTGACTA TAGTTTTGTT TGTAGCTTTG CACAAGATAT
TAGATGTGAT GCCTTTGTCA CTTGCTGAAA TACTGAATTA TTTTCCCTTT GCTGACAGTG AATTTGACTA GCTAGTAGCC
ACGCATGAAG CCAGATGGTG AAACTCAGCT TCGTCCTACA GCTGCTGGAC ATCCAGATCC TGGTTTGGGC ACATCATCTG
CAGAATACGT GGCCTCTCTA GGACCAGCTA CAGTATGATC TGTTCTCTTT CTTGTCTTTA GAAACATGAC AGTACAGGTA
GTGCAACGAC TACCTAGGAT CCTTTTCTGC TCGAAGTTCT GATGGTAAAA TTTGACTACA ATTTGATCAA GAAATAAAAG
ATACATTATT ATATGACTAA TTTCTTACCA GTTACATCGA TACTTAGTTC TTTTACCAAC CTTCTCTTAT ACTGCTCAGG
TTCAGCCCTA ATAAATAAAT TATTTCTTTT TCAGGCTCCA GTATCTTATC CATATATCAG TACCTATTAT GGAGGCACTT
ATGGTGCTTA TAGTGGACAA CCTCTGGTAA TTTACGTTAC CGATATAGTC AGATATCAGA TTTACTATAG CAGCTGATTT
TTGTTATCTA CTTTCTTTAG GTTAACGCTG CTTTAATGGC AATGCCTCCG CATTCTGTGC CCTTGGTGAC CGATGCTGTT
GTAGAGCCCA TATATGTCAA TGCAAGGCAG TATCATGGTA TATTAAGGCG GCGCCAATCT CGTGCAAAAG CTGAATCAGA
AAATAAGGCC AACAAAATCC GCAAGGTATT TCCTAAATAT TATACTTGCT TGAGCCATAT TTTCAAGCTA TTTATCAGAC
AGGGTGAAAC TGCTTTGCCA CCTCTTCAAG ATTGTTGTTG AAGATTGACC CATGCCATCA AAACAGGCCT TATCAAAATT
TCAAGAAATT TATGGGAAAA TGAAAATTAA TCTGTTTGCT CCAAGTTCAG CATGGTTGTG ACAACTTATT GGGTTTTTAC
AGTTTCCCTT TTGTTTGTGA ATTGTTCTTT TTTTTCTGAT TGATACATCC ATTGATCTCA TAGATGAATA TATGTGTTCA
TATGTGTTTG GAATTTCATT TCTTGCTTTC CTCCTTTTTC ACTGTTGCAG TTATGGATTT GCAACGCCTT Aggccccgtt
cgatctcccg tgttggagat ggattttgtt gcacgcaaaa cgagaaacct aattagcaca tgattaatta agtattaact
attataaatt tgaaaattgg attttttttt caaacaactt ttatataaaa actaaaaaaa agtaccagtt aacagtttga
aaaatgtgct aacggaaaac gaggaagttg aagtttgaag ttgaagaata gaacagggcc TTAGTCTAGA ATCCCACATA
TCAGTCAATT AAGGGGAAAA TTCCTCACTT TGGCATCCTT AATTTGATCT TCTATAGTTA TTTTGACTGC AAAACTTAGA
TTGTACCAGA TTTTAGCAAG GTTTAAGGGG GGCAATATAT CTACCCTGTT ATTTCCATCT TCCTGAGAAT ATCTTTCATC
TCTATTCAAG TTTCTATCAA AACTGACTGT GCTAACTAAT TTAAACAGAA CACCATTAAA TGATATTGTG AGTTTGTGAC
AATCTTAATT TAGACGATAT GGCTAATCCA ATAGCTTTGT CGTAAGTCAC TTTTTTCCTT TATATTGATA ACTACAGACC
GATAGAAGCA ATTTATGGTT AATTTTTTTA CTAAGGTGCT CAAGTAATGT TCTCCTCACT AAATTTAATA TAGTTTCACA
CTTGAACACG TAGAGGACCA AGCAAAAAAA AGGATATGCT CCTTGTTCTA AATGCTTTAT CATGTTTAAT GGGCACTAGT
TTCTGTTCAT ATTGAAACTC AGTTGTGTTC TTTGTTTCTC ATTTCTTTGG TACCATTTGG TTTGTTCCTT CTTCAGCCTT
ACCTACATGA GTCCCGCCAT CTGCATGCTT TGAAAAGGGC AAGGGGGTCC GGTGGTCGAT TTCTCAACTC TAAGGCTGTG
GAGGGGAAGC AAGACACTAA ATCTGTAGAT AAAAAGGATG GAGCTGTGCC ATCTGAGGAG AAGAGAGACA AGAAGTTGGC
AAATAGCATT ATCAAATTGG AGAACTCGAG CCCAACAACA CAACCAGGTG CAGATGCGTC CGATGTTGTA TGATGCAAAT
TTAGCCAATC CCTCCCTAAT CCAACCAAAT TGCCAGAATC GATCGAATTG TGTGCTTGCT TTCTGTTCGT GACAGTTTAA
GTCTGTACAT AGCTGTTAGT TTTGATGATT GGATAAATCC ATGATAGTAT AGTGAACATG TTGTGGGAGC AGTTCAGTGC
TAGGGTTTGT TGCTGAGTGT AGATTATGAA CCTTGTGTCA CTGTTGTGTT TTGCTTCTGT TAATGAATGG TAGCTTACAA
TGGG

Locus: Os08g0196700

Loading...

Locus: Os08g0196700

Loading...