Os08t0198000-00

Locus

Os08g0198000

Description

HAT dimerisation domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

WRKY105

CGSNL Gene Name

WRKY GENE 105

Oryzabase Gene Symbol Synonym(s)

OsWRKY105

Oryzabase Gene Name Synonym(s)

Transcript Evidence

ab initio prediction

Protein Evidence

NP_001061196.1 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleic acid binding (GO:0003676)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

HAT dimerisation (IPR008906)

Ribonuclease H-like (IPR012337)

Expression Databases

TENOR (Os08t0198000-00)

Others

Oryzabase (9222)

Transcript

366 bp

>Os08t0198000-00 HAT dimerisation domain containing protein.
ATGGATAGAGATGGTAATGATTCATTACATGGCACCGATCAAAATGACATTGGGCAATCG
GCACTCGGGGAATTCAGAGAACTGACTTTGTACCTTGAAGGGGGACTTTGTCCTCAAAAT
GAACAATTTGATATCCTGAAATGGTGGAAGGATAATGCGTTGACGTATCCAACTCTTGCT
AGGCTTGCACGCGACATTTTAGCAATACCTGGAAGTGCGGTTTCTGCTGAGTCTGCTTTC
GACGAAACTGATGAACGGGTGAGCCTTTTCAATCGAAAGCTTAGTCCTGAGATAGTGGAA
GCCCTCATCTGCACTCAGGATTGGATAAAATCCTCAGAAACAGGTGATGAAAACGGTGGA
AGCTGA

CDS

366 bp

>Os08t0198000-00 HAT dimerisation domain containing protein.
ATGGATAGAGATGGTAATGATTCATTACATGGCACCGATCAAAATGACATTGGGCAATCG
GCACTCGGGGAATTCAGAGAACTGACTTTGTACCTTGAAGGGGGACTTTGTCCTCAAAAT
GAACAATTTGATATCCTGAAATGGTGGAAGGATAATGCGTTGACGTATCCAACTCTTGCT
AGGCTTGCACGCGACATTTTAGCAATACCTGGAAGTGCGGTTTCTGCTGAGTCTGCTTTC
GACGAAACTGATGAACGGGTGAGCCTTTTCAATCGAAAGCTTAGTCCTGAGATAGTGGAA
GCCCTCATCTGCACTCAGGATTGGATAAAATCCTCAGAAACAGGTGATGAAAACGGTGGA
AGCTGA

Protein

122 aa

>Os08t0198000-00 HAT dimerisation domain containing protein.
MDRDGNDSLHGTDQNDIGQSALGEFRELTLYLEGGLCPQNEQFDILKWWKDNALTYPTLA
RLARDILAIPGSAVSAESAFDETDERVSLFNRKLSPEIVEALICTQDWIKSSETGDENGG
S*

CDS

chr08:5663707..5664043 (- strand) : 337 bp

chr08:5663578..5663606 (- strand) : 29 bp

FASTA

>Os08t0198000-00 class=Sequence position=chr08:5663578..5664043 (- strand)
ATGGATAGAG ATGGTAATGA TTCATTACAT GGCACCGATC AAAATGACAT TGGGCAATCG GCACTCGGGG AATTCAGAGA
ACTGACTTTG TACCTTGAAG GGGGACTTTG TCCTCAAAAT GAACAATTTG ATATCCTGAA ATGGTGGAAG GATAATGCGT
TGACGTATCC AACTCTTGCT AGGCTTGCAC GCGACATTTT AGCAATACCT GGAAGTGCGG TTTCTGCTGA GTCTGCTTTC
GACGAAACTG ATGAACGGGT GAGCCTTTTC AATCGAAAGC TTAGTCCTGA GATAGTGGAA GCCCTCATCT GCACTCAGGA
TTGGATAAAA TCCTCAGGTA CAGTGCAGCT ATATACTTCA TATCATTCAA CATGTAGTGA ACCTAGTATT TAGTATTGCT
GACTGTAACT GTGATGTTCC TGCCTGTTGG TTAACAGAAA CAGGTGATGA AAACGGTGGA AGCTGA

Locus: Os08g0198000

Loading...

Locus: Os08g0198000

Loading...