Os08t0205300-01

Locus

Os08g0205300

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET28, SDG740

Oryzabase Gene Name Synonym(s)

SET protein 28

Transcript Evidence

AK103876 (DDBJ, Best hit)

Protein Evidence

Q6ZCF6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

SET domain (IPR001214)

Full-length cDNA

J033149M20 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0205300-01)

RiceXPro (AK103876)

Others

Oryzabase (13392)

KEGG (Os08t0205300-01)

Transcript

1574 bp

>Os08t0205300-01 Hypothetical conserved gene.
CACTTCTCCCACCGCCGCCGCCGCCGCCGCCGAGGAAGAAGCTCTGCTCCGCCATGGCCG
GCGACGCGCTGCGTGCGGCCGATCTCCCCGGCCGAGGACGCGGGCTCCTCGCGGCGCGCA
GCATCCGGGAGGGGGAGGTCATCCTCACCGAGCAGCCGCTGCTCCTCTACCCGGCCTCGC
TCGCCTCCCTCCCCTCCTTCTGCTCCGCCTGCTTCCGCTCCCTCTCCGCCGCCGCATCCC
CCTGCCCCTCCTGCCGCGCCGCGGGATTCTGCTCCCCGTCCTGCGCCGCCGCCTCCCACC
CGCGCCTCCTCTGCACCGCGCTCTCCGGCGGCGGTGGCAACGGAAACCTCGCGTCCGCCG
CCGAGCCGCACCAGGAGCCGCTCCTCTTCCTTCTCTCCGCCTACTCCCTCCCGGAGCCCT
CCCTCCGCGTGCTCCTCTCCCTCTCCTCCGCCGCAACGCCGCCCCCGAGCGACCAGGACC
CGGGGAGCCTGCACGCCATGGTGGCGGCGCTGGTGCCGCCGCAGATGCTTCCGCCAGGGT
TCTCGCCGGACCTCACGGCGGCGCTCCTCTCCAAGGACCGGACCAACAGCTTCTCCATCA
TGGAGCCCTACCGCCCCGAGGTGCCGCAGCCTCTCCGGAAGGCGAGGGCCTACGCCGTGT
ACCCGCGGGCGTCGCTGCTGAACCATGATTGCCTCCCCAATGCTTGCCATTTCGATTACG
CCGATAGGCCGGGTCCCGGGAACACCGACATTGTGGTGCGAGCTCTTCACGACATCACCG
AGGGGAGGGAGGTGTGCCTCAGCTACTTCGCGGCCAATTGGCAGTACAAGGATCGGCAGC
AGAGGTTGCTGGAGGACTATGGGTTCCGATGCGAGTGTGAGCGGTGTCAGGTGGAGAGCA
AGTGGAAGCAAGATGATGATAGCGATGGCGGCGATGGGGATGACACCATGGAAGAGGAGG
AAGAGGATGGTAATGGTGGAGAAGGTGGTGATGATGGGATGGAGCAGGAGGAGGGGGATG
GTGGTAGCGATAGCGATGATGATTTCCCGCACTCATACTTCTTTGTAAGGTATCTGTGTA
ACCATGGTGAATGCTATGGCATGCTTGCGCCACTTCCGCCCTTGCCAAACGGTGAGCCGT
CCCATGTGTTTGAGTGCAATGTCTGTGGGAACCTGAAGAACGAAGATGAAATTGATGCTC
CTGATGGTGGTGATTCCAGCATGGCGGATTAGGATGAGCTAAGCATAACCGATCTGCTTG
CTGCTTCTTTTGGTGGGAGCTCATAACACTTTGGTGGTAGGACTTGGGAGTACTTCTGTA
AACTGGTTGGAGTTTTGACAAAAACGGGAGTTTAATACACCTAAATATGGAGAGATGTAT
GAACAGAACAACATTCATTGACTGAATGTGGAACTAGCAATCCTTCTTGTACTCAGCAAC
GTATATATGAATGTGTATCCGTTGTAGGGAGTCCTGCTTGTTCTGTACAATTTCTAATGC
TCCCCCTTTATCTAGAATGGTGATTTAGACTTGAGAAATTTATGCAGTCAGAAGCTGATC
TCCTGTGATACTTG

CDS

1179 bp

>Os08t0205300-01 Hypothetical conserved gene.
ATGGCCGGCGACGCGCTGCGTGCGGCCGATCTCCCCGGCCGAGGACGCGGGCTCCTCGCG
GCGCGCAGCATCCGGGAGGGGGAGGTCATCCTCACCGAGCAGCCGCTGCTCCTCTACCCG
GCCTCGCTCGCCTCCCTCCCCTCCTTCTGCTCCGCCTGCTTCCGCTCCCTCTCCGCCGCC
GCATCCCCCTGCCCCTCCTGCCGCGCCGCGGGATTCTGCTCCCCGTCCTGCGCCGCCGCC
TCCCACCCGCGCCTCCTCTGCACCGCGCTCTCCGGCGGCGGTGGCAACGGAAACCTCGCG
TCCGCCGCCGAGCCGCACCAGGAGCCGCTCCTCTTCCTTCTCTCCGCCTACTCCCTCCCG
GAGCCCTCCCTCCGCGTGCTCCTCTCCCTCTCCTCCGCCGCAACGCCGCCCCCGAGCGAC
CAGGACCCGGGGAGCCTGCACGCCATGGTGGCGGCGCTGGTGCCGCCGCAGATGCTTCCG
CCAGGGTTCTCGCCGGACCTCACGGCGGCGCTCCTCTCCAAGGACCGGACCAACAGCTTC
TCCATCATGGAGCCCTACCGCCCCGAGGTGCCGCAGCCTCTCCGGAAGGCGAGGGCCTAC
GCCGTGTACCCGCGGGCGTCGCTGCTGAACCATGATTGCCTCCCCAATGCTTGCCATTTC
GATTACGCCGATAGGCCGGGTCCCGGGAACACCGACATTGTGGTGCGAGCTCTTCACGAC
ATCACCGAGGGGAGGGAGGTGTGCCTCAGCTACTTCGCGGCCAATTGGCAGTACAAGGAT
CGGCAGCAGAGGTTGCTGGAGGACTATGGGTTCCGATGCGAGTGTGAGCGGTGTCAGGTG
GAGAGCAAGTGGAAGCAAGATGATGATAGCGATGGCGGCGATGGGGATGACACCATGGAA
GAGGAGGAAGAGGATGGTAATGGTGGAGAAGGTGGTGATGATGGGATGGAGCAGGAGGAG
GGGGATGGTGGTAGCGATAGCGATGATGATTTCCCGCACTCATACTTCTTTGTAAGGTAT
CTGTGTAACCATGGTGAATGCTATGGCATGCTTGCGCCACTTCCGCCCTTGCCAAACGGT
GAGCCGTCCCATGTGTTTGAGTGCAATGTCTGTGGGAACCTGAAGAACGAAGATGAAATT
GATGCTCCTGATGGTGGTGATTCCAGCATGGCGGATTAG

Protein

393 aa

>Os08t0205300-01 Hypothetical conserved gene.
MAGDALRAADLPGRGRGLLAARSIREGEVILTEQPLLLYPASLASLPSFCSACFRSLSAA
ASPCPSCRAAGFCSPSCAAASHPRLLCTALSGGGGNGNLASAAEPHQEPLLFLLSAYSLP
EPSLRVLLSLSSAATPPPSDQDPGSLHAMVAALVPPQMLPPGFSPDLTAALLSKDRTNSF
SIMEPYRPEVPQPLRKARAYAVYPRASLLNHDCLPNACHFDYADRPGPGNTDIVVRALHD
ITEGREVCLSYFAANWQYKDRQQRLLEDYGFRCECERCQVESKWKQDDDSDGGDGDDTME
EEEEDGNGGEGGDDGMEQEEGDGGSDSDDDFPHSYFFVRYLCNHGECYGMLAPLPPLPNG
EPSHVFECNVCGNLKNEDEIDAPDGGDSSMAD*

5'UTR

chr08:6155162..6155214 (+ strand) : 53 bp

CDS

chr08:6155215..6156393 (+ strand) : 1179 bp

3'UTR

chr08:6156394..6156437 (+ strand) : 44 bp

chr08:6157396..6157693 (+ strand) : 298 bp

FASTA

>Os08t0205300-01 class=Sequence position=chr08:6155162..6157693 (+ strand)
CACTTCTCCC ACCGCCGCCG CCGCCGCCGC CGAGGAAGAA GCTCTGCTCC GCCATGGCCG GCGACGCGCT GCGTGCGGCC
GATCTCCCCG GCCGAGGACG CGGGCTCCTC GCGGCGCGCA GCATCCGGGA GGGGGAGGTC ATCCTCACCG AGCAGCCGCT
GCTCCTCTAC CCGGCCTCGC TCGCCTCCCT CCCCTCCTTC TGCTCCGCCT GCTTCCGCTC CCTCTCCGCC GCCGCATCCC
CCTGCCCCTC CTGCCGCGCC GCGGGATTCT GCTCCCCGTC CTGCGCCGCC GCCTCCCACC CGCGCCTCCT CTGCACCGCG
CTCTCCGGCG GCGGTGGCAA CGGAAACCTC GCGTCCGCCG CCGAGCCGCA CCAGGAGCCG CTCCTCTTCC TTCTCTCCGC
CTACTCCCTC CCGGAGCCCT CCCTCCGCGT GCTCCTCTCC CTCTCCTCCG CCGCAACGCC GCCCCCGAGC GACCAGGACC
CGGGGAGCCT GCACGCCATG GTGGCGGCGC TGGTGCCGCC GCAGATGCTT CCGCCAGGGT TCTCGCCGGA CCTCACGGCG
GCGCTCCTCT CCAAGGACCG GACCAACAGC TTCTCCATCA TGGAGCCCTA CCGCCCCGAG GTGCCGCAGC CTCTCCGGAA
GGCGAGGGCC TACGCCGTGT ACCCGCGGGC GTCGCTGCTG AACCATGATT GCCTCCCCAA TGCTTGCCAT TTCGATTACG
CCGATAGGCC GGGTCCCGGG AACACCGACA TTGTGGTGCG AGCTCTTCAC GACATCACCG AGGGGAGGGA GGTGTGCCTC
AGCTACTTCG CGGCCAATTG GCAGTACAAG GATCGGCAGC AGAGGTTGCT GGAGGACTAT GGGTTCCGAT GCGAGTGTGA
GCGGTGTCAG GTGGAGAGCA AGTGGAAGCA AGATGATGAT AGCGATGGCG GCGATGGGGA TGACACCATG GAAGAGGAGG
AAGAGGATGG TAATGGTGGA GAAGGTGGTG ATGATGGGAT GGAGCAGGAG GAGGGGGATG GTGGTAGCGA TAGCGATGAT
GATTTCCCGC ACTCATACTT CTTTGTAAGG TATCTGTGTA ACCATGGTGA ATGCTATGGC ATGCTTGCGC CACTTCCGCC
CTTGCCAAAC GGTGAGCCGT CCCATGTGTT TGAGTGCAAT GTCTGTGGGA ACCTGAAGAA CGAAGATGAA ATTGATGCTC
CTGATGGTGG TGATTCCAGC ATGGCGGATT AGGATGAGCT AAGCATAACC GATCTGCTTG CTGCTTCTTT TGGTGGGTAA
GAATTCCATA CTTGCTGTCA TTATTGTTAT CGGTTTGGTC TTTTGATTTG ATATCCTACA CAGTCCAAGA CCGTAATATT
CAATCCATGA GCACTTGCTG ATCTGTATAG AGTATAAGGA AATATTTGAC TGAGCTGAAA TGCTAACCTA GTTGCAACAA
TCGTAATCCA TTTTATTTTG TTAATTAAGA TATTGTTTAT GTGGGGGATC TTTTATGGTT TTACCTTTTG AAGTGCTTCC
TTACTGGATA ATCAATCAAG CTTCTTCACT TGTATTCGGA ATACTGTTAA CTTGTTAAAG TGGATGTTAA GATCCTCGGT
GCTTGCTTTG TATTAAATAA TAATTCTGTT GTTTGGCAAA TAAGCGTGTG AAAACCACCA GAATCATCTC TATTGACAAC
AGCCACCACC CTCCACCACC ACTGCTGCAT TGTTCAATAT GCTATTGTTA TTTGTGGATT AGTGTTCTGG TTTGCTGTAA
TCGAATCGAG TCCCCTAAGA GACTTAATAC CATTTCAGTA GAAACTTGGT CATGAGATAG CTGACTAGGG TTGAGAAGTG
ATGGCCTGAT GGGATGGTAG TCACTGGAAT TTTTCTGTTA GAAAAGGAAA AAAGCTTTAG CCACATAATT CCACCCCCAA
TTTTGAAAGC GCTAGATAAC CAGGGCGCAT ATAATTATGC TTGGTCCCTC GCCTCTTTCA TACCTTTATT TTGCTCAAAT
GGACCTAAAT GTTTGGGCTA GGTGTATAAC CTGGCTTATT CCTTCAGAGA AAAAAAAATG AAACTGGAGA GGCTAATGCC
AAGTCAAATT GAAGCTGCCA GTGAAATAGC AAATCCGAAG GTTTATGTTA TGTGATAAAT CAACTATGTT GGGCATATGT
CTTTGATTCT ACAAGGGTTC AGACCATTTT TCTTTCTGTA TTATTATCTG ACAATGTGAA TTGTTATCTC ACAGGAGCTC
ATAACACTTT GGTGGTAGGA CTTGGGAGTA CTTCTGTAAA CTGGTTGGAG TTTTGACAAA AACGGGAGTT TAATACACCT
AAATATGGAG AGATGTATGA ACAGAACAAC ATTCATTGAC TGAATGTGGA ACTAGCAATC CTTCTTGTAC TCAGCAACGT
ATATATGAAT GTGTATCCGT TGTAGGGAGT CCTGCTTGTT CTGTACAATT TCTAATGCTC CCCCTTTATC TAGAATGGTG
ATTTAGACTT GAGAAATTTA TGCAGTCAGA AGCTGATCTC CTGTGATACT TG

Locus: Os08g0205300

Loading...

Locus: Os08g0205300

Loading...