Os08t0205300-02

Locus

Os08g0205300

Description

SET domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET28, SDG740

Oryzabase Gene Name Synonym(s)

SET protein 28

Transcript Evidence

AK122033 (DDBJ, Best hit)

Protein Evidence

A2YSB4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

SET domain (IPR001214)

Full-length cDNA

J033112H20 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0205300-02)

RiceXPro (AK122033)

Others

Oryzabase (13392)

KEGG (Os08t0205300-02)

Transcript

1474 bp

>Os08t0205300-02 SET domain containing protein.
ACTTCTCCCACCGCCGCCGCCGCCGCCGCCGAGGAAGAAGCTCTGCTCCGCCATGGCCGG
CGACGCGCTGCGTGCGGCCGATCTCCCCGGCCGAGGACGCGGGCTCCTCGCGGCGCGCAG
CATCCGGGAGGGGGAGGTCATCCTCACCGAGCAGCCGCTGCTCCTCTACCCGGCCTCGCT
CGCCTCCCTCCCCTCCTTCTGCTCCGCCTGCTTCCGCTCCCTCTCCGCCGCCGCATCCCC
CTGCCCCTCCTGCCGCGCCGCGGGATTCTGCTCCCCGTCCTGCGCCGCCGCCTCCCACCC
GCGCCTGCACGCCATGGTGGCGGCGCTGGTGCCGCCGCAGATGCTTCCGCCAGGGTTCTC
GCCGGACCTCACGGCGGCGCTCCTCTCCAAGGACCGGACCAACAGCTTCTCCATCATGGA
GCCCTACCGCCCCGAGGTGCCGCAGCCTCTCCGGAAGGCGAGGGCCTACGCCGTGTACCC
GCGGGCGTCGCTGCTGAACCATGATTGCCTCCCCAATGCTTGCCATTTCGATTACGCCGA
TAGGCCGGGTCCCGGGAACACCGACATTGTGGTGCGAGCTCTTCACGACATCACCGAGGG
GAGGGAGGTGTGCCTCAGCTACTTCGCGGCCAATTGGCAGTACAAGGATCGGCAGCAGAG
GTTGCTGGAGGACTATGGGTTCCGATGCGAGTGTGAGCGGTGTCAGGTGGAGAGCAAGTG
GAAGCAAGATGATGATAGCGATGGCGGCGATGGGGATGACACCATGGAAGAGGAGGAAGA
GGATGGTAATGGTGGAGAAGGTGGTGATGATGGGATGGAGCAGGAGGAGGGGGATGGTGG
TAGCGATAGCGATGATGATTTCCCGCACTCATACTTCTTTGTAAGGTATCTGTGTAACCA
TGGTGAATGCTATGGCATGCTTGCGCCACTTCCGCCCTTGCCAAACGGTGAGCCGTCCCA
TGTGTTTGAGTGCAATGTCTGTGGGAACCTGAAGAACGAAGATGAAATTGATGCTCCTGA
TGGTGGTGATTCCAGCATGGCGGATTAGGATGAGCTAAGCATAACCGATCTGCTTGCTGC
TTCTTTTGGTGGGAGCTCATAACACTTTGGTGGTAGGACTTGGGAGTACTTCTGTAAACT
GGTTGGAGTTTTGACAAAAACGGGAGTTTAATACACCTAAATATGGAGAGATGTATGAAC
AGAACAACATTCATTGACTGAATGTGGAACTAGCAATCCTTCTTGTACTCAGCAACGTAT
ATATGAATGTGTATCCGTTGTAGGGAGTCCTGCTTGTTCTGTACAATTTCTAATGCTCCC
CCTTTATCTAGAATGGTGATTTAGACTTGAGAAATTTATGCAGTCAGAAGCTGATCTCCT
GTGATACTTGAAACATTCCGTTTTGTCATGTCATGGTGTAGTTGATTGTATGGCATTGCA
TCTCTTGTCTACTGATGAGAGGTCAAATCTCATT

CDS

996 bp

>Os08t0205300-02 SET domain containing protein.
ATGGCCGGCGACGCGCTGCGTGCGGCCGATCTCCCCGGCCGAGGACGCGGGCTCCTCGCG
GCGCGCAGCATCCGGGAGGGGGAGGTCATCCTCACCGAGCAGCCGCTGCTCCTCTACCCG
GCCTCGCTCGCCTCCCTCCCCTCCTTCTGCTCCGCCTGCTTCCGCTCCCTCTCCGCCGCC
GCATCCCCCTGCCCCTCCTGCCGCGCCGCGGGATTCTGCTCCCCGTCCTGCGCCGCCGCC
TCCCACCCGCGCCTGCACGCCATGGTGGCGGCGCTGGTGCCGCCGCAGATGCTTCCGCCA
GGGTTCTCGCCGGACCTCACGGCGGCGCTCCTCTCCAAGGACCGGACCAACAGCTTCTCC
ATCATGGAGCCCTACCGCCCCGAGGTGCCGCAGCCTCTCCGGAAGGCGAGGGCCTACGCC
GTGTACCCGCGGGCGTCGCTGCTGAACCATGATTGCCTCCCCAATGCTTGCCATTTCGAT
TACGCCGATAGGCCGGGTCCCGGGAACACCGACATTGTGGTGCGAGCTCTTCACGACATC
ACCGAGGGGAGGGAGGTGTGCCTCAGCTACTTCGCGGCCAATTGGCAGTACAAGGATCGG
CAGCAGAGGTTGCTGGAGGACTATGGGTTCCGATGCGAGTGTGAGCGGTGTCAGGTGGAG
AGCAAGTGGAAGCAAGATGATGATAGCGATGGCGGCGATGGGGATGACACCATGGAAGAG
GAGGAAGAGGATGGTAATGGTGGAGAAGGTGGTGATGATGGGATGGAGCAGGAGGAGGGG
GATGGTGGTAGCGATAGCGATGATGATTTCCCGCACTCATACTTCTTTGTAAGGTATCTG
TGTAACCATGGTGAATGCTATGGCATGCTTGCGCCACTTCCGCCCTTGCCAAACGGTGAG
CCGTCCCATGTGTTTGAGTGCAATGTCTGTGGGAACCTGAAGAACGAAGATGAAATTGAT
GCTCCTGATGGTGGTGATTCCAGCATGGCGGATTAG

Protein

332 aa

>Os08t0205300-02 SET domain containing protein.
MAGDALRAADLPGRGRGLLAARSIREGEVILTEQPLLLYPASLASLPSFCSACFRSLSAA
ASPCPSCRAAGFCSPSCAAASHPRLHAMVAALVPPQMLPPGFSPDLTAALLSKDRTNSFS
IMEPYRPEVPQPLRKARAYAVYPRASLLNHDCLPNACHFDYADRPGPGNTDIVVRALHDI
TEGREVCLSYFAANWQYKDRQQRLLEDYGFRCECERCQVESKWKQDDDSDGGDGDDTMEE
EEEDGNGGEGGDDGMEQEEGDGGSDSDDDFPHSYFFVRYLCNHGECYGMLAPLPPLPNGE
PSHVFECNVCGNLKNEDEIDAPDGGDSSMAD*

5'UTR

chr08:6155163..6155214 (+ strand) : 52 bp

CDS

chr08:6155215..6155464 (+ strand) : 250 bp

chr08:6155648..6156393 (+ strand) : 746 bp

3'UTR

chr08:6156394..6156437 (+ strand) : 44 bp

chr08:6157396..6157777 (+ strand) : 382 bp

FASTA

>Os08t0205300-02 class=Sequence position=chr08:6155163..6157777 (+ strand)
ACTTCTCCCA CCGCCGCCGC CGCCGCCGCC GAGGAAGAAG CTCTGCTCCG CCATGGCCGG CGACGCGCTG CGTGCGGCCG
ATCTCCCCGG CCGAGGACGC GGGCTCCTCG CGGCGCGCAG CATCCGGGAG GGGGAGGTCA TCCTCACCGA GCAGCCGCTG
CTCCTCTACC CGGCCTCGCT CGCCTCCCTC CCCTCCTTCT GCTCCGCCTG CTTCCGCTCC CTCTCCGCCG CCGCATCCCC
CTGCCCCTCC TGCCGCGCCG CGGGATTCTG CTCCCCGTCC TGCGCCGCCG CCTCCCACCC GCGCCTCCTC TGCACCGCGC
TCTCCGGCGG CGGTGGCAAC GGAAACCTCG CGTCCGCCGC CGAGCCGCAC CAGGAGCCGC TCCTCTTCCT TCTCTCCGCC
TACTCCCTCC CGGAGCCCTC CCTCCGCGTG CTCCTCTCCC TCTCCTCCGC CGCAACGCCG CCCCCGAGCG ACCAGGACCC
GGGGAGCCTG CACGCCATGG TGGCGGCGCT GGTGCCGCCG CAGATGCTTC CGCCAGGGTT CTCGCCGGAC CTCACGGCGG
CGCTCCTCTC CAAGGACCGG ACCAACAGCT TCTCCATCAT GGAGCCCTAC CGCCCCGAGG TGCCGCAGCC TCTCCGGAAG
GCGAGGGCCT ACGCCGTGTA CCCGCGGGCG TCGCTGCTGA ACCATGATTG CCTCCCCAAT GCTTGCCATT TCGATTACGC
CGATAGGCCG GGTCCCGGGA ACACCGACAT TGTGGTGCGA GCTCTTCACG ACATCACCGA GGGGAGGGAG GTGTGCCTCA
GCTACTTCGC GGCCAATTGG CAGTACAAGG ATCGGCAGCA GAGGTTGCTG GAGGACTATG GGTTCCGATG CGAGTGTGAG
CGGTGTCAGG TGGAGAGCAA GTGGAAGCAA GATGATGATA GCGATGGCGG CGATGGGGAT GACACCATGG AAGAGGAGGA
AGAGGATGGT AATGGTGGAG AAGGTGGTGA TGATGGGATG GAGCAGGAGG AGGGGGATGG TGGTAGCGAT AGCGATGATG
ATTTCCCGCA CTCATACTTC TTTGTAAGGT ATCTGTGTAA CCATGGTGAA TGCTATGGCA TGCTTGCGCC ACTTCCGCCC
TTGCCAAACG GTGAGCCGTC CCATGTGTTT GAGTGCAATG TCTGTGGGAA CCTGAAGAAC GAAGATGAAA TTGATGCTCC
TGATGGTGGT GATTCCAGCA TGGCGGATTA GGATGAGCTA AGCATAACCG ATCTGCTTGC TGCTTCTTTT GGTGGGTAAG
AATTCCATAC TTGCTGTCAT TATTGTTATC GGTTTGGTCT TTTGATTTGA TATCCTACAC AGTCCAAGAC CGTAATATTC
AATCCATGAG CACTTGCTGA TCTGTATAGA GTATAAGGAA ATATTTGACT GAGCTGAAAT GCTAACCTAG TTGCAACAAT
CGTAATCCAT TTTATTTTGT TAATTAAGAT ATTGTTTATG TGGGGGATCT TTTATGGTTT TACCTTTTGA AGTGCTTCCT
TACTGGATAA TCAATCAAGC TTCTTCACTT GTATTCGGAA TACTGTTAAC TTGTTAAAGT GGATGTTAAG ATCCTCGGTG
CTTGCTTTGT ATTAAATAAT AATTCTGTTG TTTGGCAAAT AAGCGTGTGA AAACCACCAG AATCATCTCT ATTGACAACA
GCCACCACCC TCCACCACCA CTGCTGCATT GTTCAATATG CTATTGTTAT TTGTGGATTA GTGTTCTGGT TTGCTGTAAT
CGAATCGAGT CCCCTAAGAG ACTTAATACC ATTTCAGTAG AAACTTGGTC ATGAGATAGC TGACTAGGGT TGAGAAGTGA
TGGCCTGATG GGATGGTAGT CACTGGAATT TTTCTGTTAG AAAAGGAAAA AAGCTTTAGC CACATAATTC CACCCCCAAT
TTTGAAAGCG CTAGATAACC AGGGCGCATA TAATTATGCT TGGTCCCTCG CCTCTTTCAT ACCTTTATTT TGCTCAAATG
GACCTAAATG TTTGGGCTAG GTGTATAACC TGGCTTATTC CTTCAGAGAA AAAAAAATGA AACTGGAGAG GCTAATGCCA
AGTCAAATTG AAGCTGCCAG TGAAATAGCA AATCCGAAGG TTTATGTTAT GTGATAAATC AACTATGTTG GGCATATGTC
TTTGATTCTA CAAGGGTTCA GACCATTTTT CTTTCTGTAT TATTATCTGA CAATGTGAAT TGTTATCTCA CAGGAGCTCA
TAACACTTTG GTGGTAGGAC TTGGGAGTAC TTCTGTAAAC TGGTTGGAGT TTTGACAAAA ACGGGAGTTT AATACACCTA
AATATGGAGA GATGTATGAA CAGAACAACA TTCATTGACT GAATGTGGAA CTAGCAATCC TTCTTGTACT CAGCAACGTA
TATATGAATG TGTATCCGTT GTAGGGAGTC CTGCTTGTTC TGTACAATTT CTAATGCTCC CCCTTTATCT AGAATGGTGA
TTTAGACTTG AGAAATTTAT GCAGTCAGAA GCTGATCTCC TGTGATACTT GAAACATTCC GTTTTGTCAT GTCATGGTGT
AGTTGATTGT ATGGCATTGC ATCTCTTGTC TACTGATGAG AGGTCAAATC TCATT

Locus: Os08g0205300

Loading...

Locus: Os08g0205300

Loading...