Os08t0220600-02

Locus

Os08g0220600

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsVIL4, OsVIL1

Oryzabase Gene Name Synonym(s)

VIN3-LIKE 4, VERNALIZATION INSENSITIVE 3-LIKE 1

Transcript Evidence

AK062408 (DDBJ, Best hit)

Protein Evidence

B8BBY4 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-102-E10 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0220600-02)

RiceXPro (AK062408)

Others

Oryzabase (11846)

KEGG (Os08t0220600-02)

Transcript

606 bp

>Os08t0220600-02 Hypothetical conserved gene.
TCCTCCTCTTGCGCCGGTGCCGACCTCGCCTCGCCTCGCCTGCGTCGCGTCGATCTCGCC
AGCGGCGGCGCCAGCCGGCCGGCGTCTGCTGCGTCCTCCGCATCCTCGCTCGCCgAGAGT
TGGGGTCAAGCAAAGTTGGTTGTTTTTTACTCGAATGTCGTGAGGAACACCGAGGAATCC
TCCAGTTTCGCATGAGACCCATATGTTGAACAAAGTAGGAAGGTTCTCTGTACTGCAAGT
GTTTGGATTTCCTCGAGCCGAATGAGCTTTCACTGGTGGATGTGGTAATAAAAGTCCCTG
TTTTCAGGATTTTTCATGGACCCGGGAAAACACAATGGAATGAGTCTGAAGGACAGAAGA
GAATTAGTATATGAAGTTTCACAATGGCCACAAGGTGCCTCTGAGATTTTACAATGTTGG
ACTCGCAGAGATCTTCTTGAGCTTATCTGTGCTGAGTTGGGCAAGGAGAGGAAATACACT
AATGTTCCAAAATCTAAAATGATTGCTTATCTGTTAAAATTAGTTTTACGAAAGAATGGA
CAGCCAAAGGATGATAATGCAAATGCTTCAATTTTGGGGCAGAATAACAAAGATGACACA
GAGAAG

CDS

291 bp

>Os08t0220600-02 Hypothetical conserved gene.
ATGGACCCGGGAAAACACAATGGAATGAGTCTGAAGGACAGAAGAGAATTAGTATATGAA
GTTTCACAATGGCCACAAGGTGCCTCTGAGATTTTACAATGTTGGACTCGCAGAGATCTT
CTTGAGCTTATCTGTGCTGAGTTGGGCAAGGAGAGGAAATACACTAATGTTCCAAAATCT
AAAATGATTGCTTATCTGTTAAAATTAGTTTTACGAAAGAATGGACAGCCAAAGGATGAT
AATGCAAATGCTTCAATTTTGGGGCAGAATAACAAAGATGACACAGAGAAG

Protein

97 aa

>Os08t0220600-02 Hypothetical conserved gene.
MDPGKHNGMSLKDRRELVYEVSQWPQGASEILQCWTRRDLLELICAELGKERKYTNVPKS
KMIAYLLKLVLRKNGQPKDDNANASILGQNNKDDTEK

5'UTR

chr08:7347935..7348049 (- strand) : 115 bp

chr08:7347531..7347609 (- strand) : 79 bp

chr08:7347386..7347406 (- strand) : 21 bp

chr08:7347101..7347192 (- strand) : 92 bp

chr08:7341719..7341726 (- strand) : 8 bp

CDS

chr08:7341428..7341718 (- strand) : 291 bp

FASTA

>Os08t0220600-02 class=Sequence position=chr08:7341428..7348049 (- strand)
TCCTCCTCTT GCGCCGGTGC CGACCTCGCC TCGCCTCGCC TGCGTCGCGT CGATCTCGCC AGCGGCGGCG CCAGCCGGCC
GGCGTCTGCT GCGTCCTCCG CATCCTCGCT CGCCggtgag catccatggc catgctcatt ctcatctcgc tctacccgcg
ctgttttttt cgaattcgcg ttagccctag cttttcttct agatctggaa gcagcttttc tctttgcact ttttgcgtta
gcccttgcaa taacaatagt aacagtttaa tctgttccca atagagaatt ttggggttca accgaaccct catgtcccag
ctaggtccgc ccctgtCAGT GCGACTGCCT TGTTGCAACT TTTTTTTTTG TTTTTGGTTA TACTCCTATC AACTATTCCT
GAGTGTACAA TGCGATAAGA TTTTGTTCCC TTCCCTGCAG AGAGTTGGGG TCAAGCAAAG TTGGTTGTTT TTTACTCGAA
TGTCGTGAGG AACACCGAGG AATCCTCCAG TTTCGCATGG TAGGGTCCAA TGCCTTTTTC TGACTAAAAA GCTGTTGGTT
TTGTTAAGTG TTGTTATCAC CATTTTATGA AATGTTTACA TGTGCCCAAC AACTTAGTAT TATCGTTTTC TCCAACCATG
CAGAGACCCA TATGTTGAAC AAAGGTGAAG CTGTGCTGTG GAGACCTGAT AAAATTTTCT AATAATGCTT GTGCAAATGA
AGAATACTGT TCATCTCACG CTATTCCTGT GTTCTTTCTC AAGAATGCTT TGCTCCTATT CTTTTATTGA AATCAATTTG
TGTTATTATC TTCCCATTCG TAAGGTGCTG ACTAGTTCAC TTTTTTATGT CATAGAGTAG GAAGGTTCTC TGTACTGCAA
GTGTTTGGAT TTCCTCGAGC CGAATGAGCT TTCACTGGTG GATGTGGTAA TAAAAGTCCC TGTTTTCAGG TATACGCTGA
CTGTAGTGTT TTGGGGATAT ACGCTACACT AATAATAGAG AACACATACA AATTAATCCC TATAAGTGAA CTGGAACTAC
TGTGTTATTA GTGTGTTGGC CAGATTTGGA TGACTAAGGT CAAATGCTAA AAATCATTTG GAATCTTTCA AAAAAGGACC
ATTTGGATTA CTATTCCGTA CATGCTCTCA GGCCCTTCCA CGTTCTACTT TTCTAATGGC ATAAGTAATG TATCTGCCTT
GATTTGCACC ACCAATATCA GCTAATACTT TAGTTCCTGT TCCATCTCCT GAAAACAATG GTCCTTCAAT TTCGCAGTAT
CAGTCCTTTC ACTGTATGCT TTCCTACCCA AGCTTCTCCT TCATATATTT AAAAGAATGG GTAAATATAG AACAGAATAA
AGTGGCTACA CTATGGATCA GTCCGGTGAA CAATTATTGT GACACAGTTT TTTTCCCAAT AAACTGGGCA TGTCTTGTGA
AACAGAGTGA TCTCTGTCTT TATGATAGAC AAATAACTAT GTTGGAGTTT GCTAGAACTA CTTGTAAGGA AGATGCCATT
AAGTGACCAC CTGAAATCGT GTTGTAGTGT CATTCCATAA CATTTATTTA AGATTTCTCC AATGGAAGTT GTATCTAAAT
ATGCCTAATA TTTTGCATAT GTAGTGTTTG CTCTTTGGAA TTATAAATCA TTCTAGGATG CTGTTCCAAT CAGTTTGGGA
AGCTCAGGTT TTCATCAAAG ACGATTAGTA AAATTTCTGT CAGTCTGCAA AATTTGTGGT ATGGTAAAAT TCCTTTAAAG
TATAGAAAAT TTAAGCTGAC AAACAAAAGT TAGGGCCATT GTATATTACA TCAAAAGATT GTTTCATTCT GTTGCTATCA
ATCTTAAATA ACGATTTCAG GGTGCAGGAT CCAGGTTCCC ATTGGGCCAC GTGGCACTTT ACAAATTTTT GTAAGGCTAC
TCTGAAATTG TGCCACGTGG CCTCCCCTAT GCATATTTAA ACTGCATTCT CCTGTCCACT GAACTGTTAG GAAAACTCTG
GAGTCAATAA ATCACCTTTG CCTGACCCTT GTGAAGAAGT TAGAGATGTA ACCCATCCGA AGTCTCTAGA AAAATTAAGG
TATTACATGG TCCTTCACGT GTATTAAGTA TAGGCAGTCA AAAAGGTAAA ATTCTCTACA CGCACAAACT ATTTCAGTAC
TCACATAGTC ACATATTGAT TTCCAAGACC TTGGATGCTT TAACTTTTCA AGACTGGTTT TAACTTTTAA TACAAAGAGT
AATCTTTTAT ATATGGCTCT GCGTATTAAG CTGACAATTA GAGTCATTTG CCTAAAAAGT TACGCCTTAA ATAAATTTCG
TAATTTTCCT ATAGGTTGAC AAATTCTGTA AATCATACTA ATTCAAAAGA CACATCTTCC AAAGTATTTG TTCAAGGTAT
GTATATACGC TTAAACAAAT TAATCTTCCA TTAGCAAAAT TTGTTTTCAG GTTGAATTAT AATTATACAC CAGACAAGTA
CAGCTAGCTA AATGCGGCAG AGAAGAATTA GCCATGCATA AACTAATTAA CCATATTACT CTATTTGTTG ATAATATTGC
TCTAATTATG TTCCATTGTA CCTATGATTA GCTTATATTA TTTTTAAGAT GTGGGGGGTA TCGTATATGA GACTACAGAG
GGGACTAGGT GACACTGGTA GATTAGCACA AGAAATGTCT CTTAGAGAGA CTTGTCAAAA ACTATATCCT TTAGTTTTCA
GTCCACTAAT CATCTAATCT TACTAATTAT TAATAGGTGT TAATCACTCT GTCTAATGGA AGAGAAAAAC AAAGGTTTGA
AAGTAAATAG GCAAGTACTA CACATAattt tgctttctgt attaattctt ttacaatgct taaatcttta cataaatacg
gttattATTA CAGGTTAATC GTTCGTCAAC CTTTTCAAAA TTCATTAAAT AGGTTCTTCT AAATCTACAA GTGTATAGAT
TTTTTTTAAA GAAAAGAAAT TATCAAGTAC TGCATTTGAA ACTTTAAACA ACAACAACAA TAATTGTTCT AAATAAGTAA
ATATATCATA GCTATAAGTT GGTGTGCCGA TGGTGCGCCA ATTTTCTACG ATATGGAAGC GGCGAATTGG GAAAGGATAG
GGTGGTGAGA TTTTATATTT GTTTCTAATT TTTAGGGTAT TCAGTGTAAT GTTGGACTAC TCTATAAATT TGAAAAACAT
ATGGACTAAA GTAAGAAATA TGATTGCCCG ACATGAAAAA TCAAAGCTAT CTCTAGAGTT ACTTTGCATT ATGGGATAAA
CAAATTTGAG ACATGTTACC TCATCCTACA TGATACTTTG AGGTCCTTTA TAGGAGGGTC TTGCACTATG AATGTCCAAA
GAGAGGTGGT ATAGCTATAG TTTTCCGAAT TATACATATG GAGCTACGAA TTATGACATC TAAATGGTGT ACTACTTGCA
ATAGAAGATA TGGAGGCGTG TCCCTATCCA TTCACATGTG GCTCTTCAAA TAGCACGTGA ACTTTGTTGC CCTCTCGTAG
TCATGACAAT ATTTTCGACT ACTGAGAAGA TAAGCAAATA TTGAGAAAAA AAAGAGAGAG CGTGGTAGAT ATACAAATGA
TAAGATTTTT AACCATCAAA ATAATGGATT TAATaatcct aaagtaaaag aaatagagag aatttaaaag gttataatta
ggccgaaaga aaataaaaat atgggaagaa ggaaaagaac aaaatatTTT CCATTTCTTT CATAACCAGT TAAAAAAACA
ATCCAACTGT TAGGGCAATT GTAAGAAACC TCTAATTATT GAAGTCCCAA ACGATTTTCA TATAAAACTT CGCCTTTTAG
CCTTATCTTA TTAATAATAA TCAAATTGAC CATCAACCAA CATATATTTG ACATCATTCT TTTTTTCCTC TGTAATTTAA
ATATTTACAA ATATAATGTT TTCATAAAAT TGAAAAACTG CTAAAAGATC TCTTTAAAAT GTTACGCTTT TACGAATAAC
AATAAATAGT ACGTGTAGTA TAAATATGGT TTGCTATATG GATGGTGCGC TAACGGCGCA CCAATTTTCT AGTGTTATCT
AATTGCTGAT CGATCCTGAT CGCCAAGGGA CCGATCAGGT CAATTCATCG TCGATCAGCC TTGATTCATC GTCGATCAGC
CTTGATTAAT CGACCTGATC GATACTATGT ATACCAGAAC CTATATTCTA TATAGTGCAC AGTATAAAGC AATCACAGTG
CATAATTGAT GGCAGGATGG TCAATTACTT GCCGTAGTAT AAAGCAATCA TTGTATAAAG CAACCAGCAG TAGTAGCACA
TCTTCACATG TGCTAAACCC TAAGACTTGT TCTAAAAATG ATCATAGGTG CTctgatcag acgattaatc gcgcctgatt
gacgattaac cggacgatca gatttctgat cgaatgaatg tccctaatcg gattcagggg attgatcagg acaattaatt
gcgattaatc ggacgatcag ataacactga ttgctATAGC AATAGCAGTT GCTTTCCTCT CTCCAGTCTC CACCATAGGT
TGTGTGGAGT CCACCCAAGA ATTTCTCTTG TTCCCTTGTT CACTCTTTCT TTTTTTCTTC GTCCGTGTTT ATCTACTTTT
GTTGAATCGA CAGTTGTTCA AAATCTTGGA TTTGTTGGCC AGTTGGTAGA CTCATGGTTT TTAAGGCAGT AAGGCGTCCT
AAGGCGACCC CGGACTGCCT TATCGCCATA GCGGTAAGAC GTAAGGCGAG GCGACACCTT AGGCACTCCA TACTAATTAG
GTGGCAAACA AAATAATCTA ATATGCTAGC AAATCAAAGT TGCATTTTAA GAGCAGTACA ACGCGCATAT ATATACCTTG
TTCTTGGCAA CTCTTGAGCC CACTAGATGG TTATAATAAT TACTTAACAA GATATCAATT TATTAACTAC TAACAGGGAG
TCAGGGATGC AGGGGAGGGG CAGGGAGTAA AACAGAGCAG TAGAGGAAGG AGTTTAGTAG ATGAAATGTA GAGGAGAGAG
AGGAAAGACC ACAACATAGt actctctccg tccctaaata tttgacgccg ttgacttttt gaaatatgtt tgacagttag
tcttattcaa aaaatttaag taattattaa ttcttttcct atcattgatt cattgttaaa tatactacta ctactcaagt
ttttgaataa tattcacaaa agtttttgaa taagacgaat ggtcaaacat gtttaaaaaa gtcaacggcg tcaaatattt
agggacaaag ggagtGGCAA AAGAGGGAGA AGAGTACATA GGATGTAGAA GAGGGGGGAG GAAACACCAA AACAGAGCAG
CAGAGGAAGG ATAAGAGCAG AGCAGAGGAA GGTGCAAAGC AGGATCACGT AGAGCAGAGA AAGAAACAGA GGAAAGTAGA
GGGTGGAGGG AAGAGAAAGA AGAGCATGCC CGCTTAGTTT TTGTGTCAAT GGAGGACCAG GATGATGGCG CAGGTGCCGA
GGACCAGGAT GATGGCGCAG GCACAGGATA GGCACATGTG ACAGCTGGGA TTGCCGCTAG GGATGGAGAA GTCACCAGGG
ATGGATCGCC ATCGCCACAG CCTCAGGCTC CAGCGACCCT CTTTCTGTTG TTTTCTCCCT GATTTGGTGG GATTTGGTGC
GTGGGGACCT TTTCACCCCT AAGATTGGCG CTTCTGTTAG TTCTGTTTCG TGCCCAGGGC CGCACCAATT TTTTTGGGCC
CTTCAACCAA TCGCGGCAAA AACTGCGCCT TCAACTTCCT CTGGCGTCGC CTTTAACCGT TGTAGCACCT AAGGACGTGA
TATCGACGTC ATAGCGACGC CTTGGGCATA AGGCGGACGC CATAAACAAT ATGGTAAGGC GGGCTAGACG CAGTGACTCC
TGGCACTGGC AGCGCCTTAC CTCCATAGCG ACGCTATGGC GACGCCTTGA CACTTAATTT TGGATTTTTT TTAACTGTAG
TACAAAATAC AAGTTATTAT AAAATCCCAA CTAAATTGAT TGAGTTAAAT TGGGTTTTGG TTGACTTACG AAGTTATGGT
CATCCATTGG ATTGTTGCCA GGTAGTCAGC TGATTGTGTA TATGACTCAA CTATACATTT TGTTTGTTGG TATCAGTATA
TGATACTATC ACTTATTGTG TCCTTTAGAT GTCAATCTGC ATTTTTACTC TGTCCGTTGC AGCACACTTA CTTTTCTTTC
TTTATTTGTA TATACTCATC TCTATTGAAT CCTTGCTAGA TGGTATTTGC TATAGGCCTG GACCTCATTA TTCTATTTTC
CAGGATTTTT CATGGACCCG GGAAAACACA ATGGAATGAG TCTGAAGGAC AGAAGAGAAT TAGTATATGA AGTTTCACAA
TGGCCACAAG GTGCCTCTGA GATTTTACAA TGTTGGACTC GCAGAGATCT TCTTGAGCTT ATCTGTGCTG AGTTGGGCAA
GGAGAGGAAA TACACTAATG TTCCAAAATC TAAAATGATT GCTTATCTGT TAAAATTAGT TTTACGAAAG AATGGACAGC
CAAAGGATGA TAATGCAAAT GCTTCAATTT TGGGGCAGAA TAACAAAGAT GACACAGAGA AG

Locus: Os08g0220600

Loading...

Locus: Os08g0220600

Loading...