Os08t0220600-03

Locus

Os08g0220600

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsVIL4, OsVIL1

Oryzabase Gene Name Synonym(s)

VIN3-LIKE 4, VERNALIZATION INSENSITIVE 3-LIKE 1

Transcript Evidence

AK063389 (DDBJ, Best hit)

Protein Evidence

B8BBY4 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-114-G12 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0220600-03)

Others

Oryzabase (11846)

Transcript

1771 bp

>Os08t0220600-03 Hypothetical conserved gene.
TTAAGAGCAGTACAACGCGCATATATATACCTTGTTCTTGGCAACTCTTGAGCCCACTAG
ATGGTTATAATAATTACTTAACAAGATATCAATTTATTAACTACTAACAGGGAGTCAGGG
ATGCAGGGGAGGGGCAGGGAGTAAAACAGAGCAGTAGAGGAAGGAGTTTAGTAGATGAAA
TGTAGAGGAGAGAGAGGAAAGACCACAACATAGtactctctccgtccctaaatatttgac
gccgttgactttttgaaatatgtttgacagttagtcttattcaaaaaatttaagtaatta
ttaattcttttcctatcattgattcattgttaaatatactactactactcaagtttttga
ataatattcacaaaagtttttgaataagacgaatggtcaaacatgtttaaaaaagtcaac
ggcgtcaaatatttagggacaaagggagtGGCAAAAGAGGGAGAAGAGTACATAGGATGT
AGAAGAGGGGGGAGGAAACACCAAAACAGAGCAGCAGAGGAAGGATAAGAGCAGAGCAGA
GGAAGGTGCAAAGCAGGATCACGTAGAGCAGAGAAAGAAACAGAGGAAAGTAGAGGGTGG
AGGGAAGAGAAAGAAGAGCATGCCCGCTTAGTTTTTGTGTCAATGGAGGACCAGGATGAT
GGCGCAGGTGCCGAGGACCAGGATGATGGCGCAGGCACAGGATAGGCACATGTGACAGCT
GGGATTGCCGCTAGGGATGGAGAAGTCACCAGGGATGGATCGCCATCGCCACAGCCTCAG
GCTCCAGCGACCCTCTTTCTGTTGTTTTCTCCCTGATTTGGTGGGATTTGGTGCGTGGGG
ACCTTTTCACCCCTAAGATTGGCGCTTCTGTTAGTTCTGTTTCGTGCCCAGGGCCGCACC
AATTTTTTTGGGCCCTTCAACCAATCGCGGCAAAAACTGCGCCTTCAACTTCCTCTGGCG
TCGCCTTTAACCGTTGTAGCACCTAAGGACGTGATATCGACGTCATAGCGACGCCTTGGG
CATAAGGCGGACGCCATAAACAATATGGTAAGGCGGGCTAGACGCAGTGACTCCTGGCAC
TGGCAGCGCCTTACCTCCATAGCGACGCTATGGCGACGCCTTGACACTTAATTTTGGATT
TTTTTTAACTGTAGTACAAAATACAAGTTATTATAAAATCCCAACTAAATTGATTGAGTT
AAATTGGGTTTTGGTTGACTTACGAAGTTATGGTCATCCATTGGATTGTTGCCAGGTAGT
CAGCTGATTGTGTATATGACTCAACTATACATTTTGTTTGTTGGTATCAGTATATGATAC
TATCACTTATTGTGTCCTTTAGATGTCAATCTGCATTTTTACTCTGTCCGTTGCAGCACA
CTTACTTTTCTTTCTTTATTTGTATATACTCATCTCTATTGAATCCTTGCTAGATGGTAT
TTGCTATAGGCCTGGACCTCATTATTCTATTTTCCAGGATTTTTCATGGACCCGGGAAAA
CACAATGGAATGAGTCTGAAGGACAGAAGAGAATTAGTATATGAAGTTTCACAATGGCCA
CAAGGTGCCTCTGAGATTTTACAATGTTGGACTCGCAGAGATCTTCTTGAGCTTATCTGT
GCTGAGTTGGGCAAGGAGAGGAAATACACTAATGTTCCAAAATCTAAAATGATTGCTTAT
CTGTTAAAATTAGTTTTACGAAAGAATGGACAGCCAAAGGATGATAATGCAAATGCTTCA
ATTTTGGGGCAGAATAACAAAGATGACACAG

CDS

286 bp

>Os08t0220600-03 Hypothetical conserved gene.
ATGGACCCGGGAAAACACAATGGAATGAGTCTGAAGGACAGAAGAGAATTAGTATATGAA
GTTTCACAATGGCCACAAGGTGCCTCTGAGATTTTACAATGTTGGACTCGCAGAGATCTT
CTTGAGCTTATCTGTGCTGAGTTGGGCAAGGAGAGGAAATACACTAATGTTCCAAAATCT
AAAATGATTGCTTATCTGTTAAAATTAGTTTTACGAAAGAATGGACAGCCAAAGGATGAT
AATGCAAATGCTTCAATTTTGGGGCAGAATAACAAAGATGACACAG

Protein

95 aa

>Os08t0220600-03 Hypothetical conserved gene.
MDPGKHNGMSLKDRRELVYEVSQWPQGASEILQCWTRRDLLELICAELGKERKYTNVPKS
KMIAYLLKLVLRKNGQPKDDNANASILGQNNKDDT

5'UTR

chr08:7341719..7343203 (- strand) : 1485 bp

CDS

chr08:7341433..7341718 (- strand) : 286 bp

FASTA

>Os08t0220600-03 class=Sequence position=chr08:7341433..7343203 (- strand)
TTAAGAGCAG TACAACGCGC ATATATATAC CTTGTTCTTG GCAACTCTTG AGCCCACTAG ATGGTTATAA TAATTACTTA
ACAAGATATC AATTTATTAA CTACTAACAG GGAGTCAGGG ATGCAGGGGA GGGGCAGGGA GTAAAACAGA GCAGTAGAGG
AAGGAGTTTA GTAGATGAAA TGTAGAGGAG AGAGAGGAAA GACCACAACA TAGtactctc tccgtcccta aatatttgac
gccgttgact ttttgaaata tgtttgacag ttagtcttat tcaaaaaatt taagtaatta ttaattcttt tcctatcatt
gattcattgt taaatatact actactactc aagtttttga ataatattca caaaagtttt tgaataagac gaatggtcaa
acatgtttaa aaaagtcaac ggcgtcaaat atttagggac aaagggagtG GCAAAAGAGG GAGAAGAGTA CATAGGATGT
AGAAGAGGGG GGAGGAAACA CCAAAACAGA GCAGCAGAGG AAGGATAAGA GCAGAGCAGA GGAAGGTGCA AAGCAGGATC
ACGTAGAGCA GAGAAAGAAA CAGAGGAAAG TAGAGGGTGG AGGGAAGAGA AAGAAGAGCA TGCCCGCTTA GTTTTTGTGT
CAATGGAGGA CCAGGATGAT GGCGCAGGTG CCGAGGACCA GGATGATGGC GCAGGCACAG GATAGGCACA TGTGACAGCT
GGGATTGCCG CTAGGGATGG AGAAGTCACC AGGGATGGAT CGCCATCGCC ACAGCCTCAG GCTCCAGCGA CCCTCTTTCT
GTTGTTTTCT CCCTGATTTG GTGGGATTTG GTGCGTGGGG ACCTTTTCAC CCCTAAGATT GGCGCTTCTG TTAGTTCTGT
TTCGTGCCCA GGGCCGCACC AATTTTTTTG GGCCCTTCAA CCAATCGCGG CAAAAACTGC GCCTTCAACT TCCTCTGGCG
TCGCCTTTAA CCGTTGTAGC ACCTAAGGAC GTGATATCGA CGTCATAGCG ACGCCTTGGG CATAAGGCGG ACGCCATAAA
CAATATGGTA AGGCGGGCTA GACGCAGTGA CTCCTGGCAC TGGCAGCGCC TTACCTCCAT AGCGACGCTA TGGCGACGCC
TTGACACTTA ATTTTGGATT TTTTTTAACT GTAGTACAAA ATACAAGTTA TTATAAAATC CCAACTAAAT TGATTGAGTT
AAATTGGGTT TTGGTTGACT TACGAAGTTA TGGTCATCCA TTGGATTGTT GCCAGGTAGT CAGCTGATTG TGTATATGAC
TCAACTATAC ATTTTGTTTG TTGGTATCAG TATATGATAC TATCACTTAT TGTGTCCTTT AGATGTCAAT CTGCATTTTT
ACTCTGTCCG TTGCAGCACA CTTACTTTTC TTTCTTTATT TGTATATACT CATCTCTATT GAATCCTTGC TAGATGGTAT
TTGCTATAGG CCTGGACCTC ATTATTCTAT TTTCCAGGAT TTTTCATGGA CCCGGGAAAA CACAATGGAA TGAGTCTGAA
GGACAGAAGA GAATTAGTAT ATGAAGTTTC ACAATGGCCA CAAGGTGCCT CTGAGATTTT ACAATGTTGG ACTCGCAGAG
ATCTTCTTGA GCTTATCTGT GCTGAGTTGG GCAAGGAGAG GAAATACACT AATGTTCCAA AATCTAAAAT GATTGCTTAT
CTGTTAAAAT TAGTTTTACG AAAGAATGGA CAGCCAAAGG ATGATAATGC AAATGCTTCA ATTTTGGGGC AGAATAACAA
AGATGACACA G

Locus: Os08g0220600

Loading...

Locus: Os08g0220600

Loading...