Os08t0223900-01

Locus

Os08g0223900

Description

Bicyclic triterpene poaceatapetol synthase, Pollen coat formation

RAP-DB Gene Symbol Synonym(s)

OsOSC12/OsPTS1, OsOSC12, OsPTS1

RAP-DB Gene Name Synonym(s)

Oxidosqualene cyclase 12, Poaceatapetol synthase 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsOSC12/OsPTS1, OsOSC12, OsPTS1, OSC12, PTS1

Oryzabase Gene Name Synonym(s)

Oxidosqualene cyclase 12, poaceatapetol synthase 1

Transcript Evidence

BT063365 (maize)

Protein Evidence

Q0J778

Literature

PMID: 29426861

Note

Manual Curation

October 26, 2018

Gene Ontology (GO)

Molecular Function: intramolecular transferase activity (GO:0016866)

Functional domain (InterPro)

Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid (IPR008930)

Squalene cyclase (IPR018333)

Squalene cyclase, N-terminal (IPR032697)

Squalene cyclase, C-terminal (IPR032696)

Terpene synthase, conserved site (IPR002365)

Expression Databases

TENOR (Os08t0223900-00)

Others

Oryzabase (22266)

KEGG (Os08t0223900-00 (EC:5.4.99.8))

Transcript

2377 bp

>Os08t0223900-01 Bicyclic triterpene poaceatapetol synthase, Pollen coat formation
ACAATATGTGGAAGCTCAAGATTGCCGAGGGAGGACCATGGCTAAAGAGTGGAAACAGTC
ATGTTGGAAGAGAAACATGGGAATTTGACCCAAATTTTGGAACAAGTGAAGAGCGGGAGG
CGGTTGAGGCTGCACGGATAGAGTTCCAGAAGAATAGGTTCAGAACAAGACACACCTCCG
ATGTTTTGGCTCGCATGCAGTTAGCTAAGGCGAACAACTTCAGTATTGATCTACAGAAAG
AAAAAGATGGAAACCCCATAAATATTGACACAGCTACAGTATCAGATATACTGAAGAAGG
CACTCAGTTATTTCTCAGCCATACAGGCATATGATGGGCACTGGCCAGGGGATTTCCCAG
GCCCACTGTTTACCACTGCAACCATGATCATAGTTCTATATGTCACAGAGTCATTAACTA
TTACACTGTCATCGGAACATCACAAGGAGATCTGTCGATATCTGTACAATCGTCAGAACA
TCGATGGAGGATGGGGACTACATGCAGAAGGTGAAAGTTCCATGCTTAGCACAGCTCTCA
ATTATACTGCTCTGAGACTACTTGGGGAGAATGTTGATGATGGACCAGATATATCCATGC
ATAAAGCAAGAAAATGGATACATGACCATGGAGGTGCAACAATGATACCGATCTTGGGAA
AAGTGTGGCTCTCGGTGCTTGGAGTTTTTGACTGGTCAGGTGTAAATCCTATTCCCCCAG
AATTATTTCTTCTTCCATCTTTCGTTCCTATCCAACCAGGACGATTATGGAGTCACTTCC
GAATGGCTTTTATTCCCATGTCTTATTTGTATGGAAAAAAGTTTGTCGGTCCTATAACAA
GATTGGTTATATCATTAAGGGAAGAGCTACATATTCATCCCTATAAAAAGATTGACTGGA
AGGAGGCACGCAAATTATGTGCAAAGGAAGATGCCTATAATCCACATATGTGGCTACAAG
AGTGCCTATCTGACTGCCTTTATAGTTTTGGTGAGCCGTTTCTTACACGTTGGCCAATTT
CCTACATGAGAAAAAGAGCTCTATACCAAATTGCTGAGTTCTTGAAGTATGAAGATGAAA
ATTCTCAGTATATCTGCATTGGTGCTGCACAGAAGGCATTATCCATGTTGTGCTGTTGGA
TTGAAAATCCCAATTCAGATGCATTCAAGCGTCATTTGGCTAGAGTAGCTGATTTTCTAT
GGGTTGGCGAAGATGGCATGAAAGTTCGGGTCTGTGCGGGTCAATTATGGGATGTTGCTT
TCGCAGTCCAAGCGATATTAGCGTGTAGCATCGCAGAAGAATTTGGAAGTACCCTTAAGA
AAGCACATGGTTTCATAAAAACTTCCCAGATTATGGACAATCCTTCTGGTGACTTCAGCA
GAAAGTACCGTCACATATCTAAAGGAGGATGGGCCTTCCAGGTTGCAGATCAGGGGTGGC
AGGTTTCAGATTGCACAGCAGAAGCTCTTAAGGCTTTGCTACTGCTGTCAAAGTGTTTGT
CAGATGGTGCAGATTATCAAATGGAAACCTACTGCTACTTTGACGCGGTGAATGTATTAC
TCTCGTTACAGAACCCAAATGGTGGGTATGGAGCATGGGAGCTAGCTCGCACATATCCAT
GGATGGAGATTTTCAACATGACAGAGATATATGCAGACATCATTGTGGAGCATCAGTACG
TAGAGTGTACCTCATCAGTCATCCAAGCATTGGCATTGTTCCGGGAGAAGTACCCTGGGC
ATCGGAAAGATGAAATAGATCAATGCATCAGGAAAGCAACAGAATTCATCGAGAAGTTAC
AGAATGATGATGGATCATGGTTTGGATCATGGGGTATTTGCTTCACGTATGGAACATGGT
TTGCAATAGAGGGTCTGTCAGCCGTGGGGCAGTGTTATGATGACAGCACCTGCATTCGGA
AAGCCTGTAAGTTTCTGTTATCAAAGCAACTAACAAATGGTGGATGGGGGGAGAGTCATC
TTTCATCCAGAACCAAGGCATACACAAACCTAGATGGGGAGAAATCACATATAGTCAATA
CTGCATGGGCAATGTTGGCACTCATGAAAGCTGGACAGGTAGAGAGAGACCCCGCTCCTC
TGCACAAAGCAGCAAGACTTATCATGAGCATGCAGCTCAGTGATGGTGACTTTCCACAAG
AGGAAATGATCGGAAGTTTCTTGAAAAATGGCCCCTTGTGTTATATGGCTTATCGCAATA
TATTCCCAATATGGGCTCTTGGAGAGTATCAGAAATTAGTATTTCAGAACTATCAGACCT
CTAGCATCAAGCAAACAAATATAGCTCCATCTGCTGGCAATGCTGCTCTGAAGAATTCAG
CAAGTACAACAGCGCCAACTTGATTTCTTGGCAGAAT

CDS

2358 bp

>Os08t0223900-01 Bicyclic triterpene poaceatapetol synthase, Pollen coat formation
ATGTGGAAGCTCAAGATTGCCGAGGGAGGACCATGGCTAAAGAGTGGAAACAGTCATGTT
GGAAGAGAAACATGGGAATTTGACCCAAATTTTGGAACAAGTGAAGAGCGGGAGGCGGTT
GAGGCTGCACGGATAGAGTTCCAGAAGAATAGGTTCAGAACAAGACACACCTCCGATGTT
TTGGCTCGCATGCAGTTAGCTAAGGCGAACAACTTCAGTATTGATCTACAGAAAGAAAAA
GATGGAAACCCCATAAATATTGACACAGCTACAGTATCAGATATACTGAAGAAGGCACTC
AGTTATTTCTCAGCCATACAGGCATATGATGGGCACTGGCCAGGGGATTTCCCAGGCCCA
CTGTTTACCACTGCAACCATGATCATAGTTCTATATGTCACAGAGTCATTAACTATTACA
CTGTCATCGGAACATCACAAGGAGATCTGTCGATATCTGTACAATCGTCAGAACATCGAT
GGAGGATGGGGACTACATGCAGAAGGTGAAAGTTCCATGCTTAGCACAGCTCTCAATTAT
ACTGCTCTGAGACTACTTGGGGAGAATGTTGATGATGGACCAGATATATCCATGCATAAA
GCAAGAAAATGGATACATGACCATGGAGGTGCAACAATGATACCGATCTTGGGAAAAGTG
TGGCTCTCGGTGCTTGGAGTTTTTGACTGGTCAGGTGTAAATCCTATTCCCCCAGAATTA
TTTCTTCTTCCATCTTTCGTTCCTATCCAACCAGGACGATTATGGAGTCACTTCCGAATG
GCTTTTATTCCCATGTCTTATTTGTATGGAAAAAAGTTTGTCGGTCCTATAACAAGATTG
GTTATATCATTAAGGGAAGAGCTACATATTCATCCCTATAAAAAGATTGACTGGAAGGAG
GCACGCAAATTATGTGCAAAGGAAGATGCCTATAATCCACATATGTGGCTACAAGAGTGC
CTATCTGACTGCCTTTATAGTTTTGGTGAGCCGTTTCTTACACGTTGGCCAATTTCCTAC
ATGAGAAAAAGAGCTCTATACCAAATTGCTGAGTTCTTGAAGTATGAAGATGAAAATTCT
CAGTATATCTGCATTGGTGCTGCACAGAAGGCATTATCCATGTTGTGCTGTTGGATTGAA
AATCCCAATTCAGATGCATTCAAGCGTCATTTGGCTAGAGTAGCTGATTTTCTATGGGTT
GGCGAAGATGGCATGAAAGTTCGGGTCTGTGCGGGTCAATTATGGGATGTTGCTTTCGCA
GTCCAAGCGATATTAGCGTGTAGCATCGCAGAAGAATTTGGAAGTACCCTTAAGAAAGCA
CATGGTTTCATAAAAACTTCCCAGATTATGGACAATCCTTCTGGTGACTTCAGCAGAAAG
TACCGTCACATATCTAAAGGAGGATGGGCCTTCCAGGTTGCAGATCAGGGGTGGCAGGTT
TCAGATTGCACAGCAGAAGCTCTTAAGGCTTTGCTACTGCTGTCAAAGTGTTTGTCAGAT
GGTGCAGATTATCAAATGGAAACCTACTGCTACTTTGACGCGGTGAATGTATTACTCTCG
TTACAGAACCCAAATGGTGGGTATGGAGCATGGGAGCTAGCTCGCACATATCCATGGATG
GAGATTTTCAACATGACAGAGATATATGCAGACATCATTGTGGAGCATCAGTACGTAGAG
TGTACCTCATCAGTCATCCAAGCATTGGCATTGTTCCGGGAGAAGTACCCTGGGCATCGG
AAAGATGAAATAGATCAATGCATCAGGAAAGCAACAGAATTCATCGAGAAGTTACAGAAT
GATGATGGATCATGGTTTGGATCATGGGGTATTTGCTTCACGTATGGAACATGGTTTGCA
ATAGAGGGTCTGTCAGCCGTGGGGCAGTGTTATGATGACAGCACCTGCATTCGGAAAGCC
TGTAAGTTTCTGTTATCAAAGCAACTAACAAATGGTGGATGGGGGGAGAGTCATCTTTCA
TCCAGAACCAAGGCATACACAAACCTAGATGGGGAGAAATCACATATAGTCAATACTGCA
TGGGCAATGTTGGCACTCATGAAAGCTGGACAGGTAGAGAGAGACCCCGCTCCTCTGCAC
AAAGCAGCAAGACTTATCATGAGCATGCAGCTCAGTGATGGTGACTTTCCACAAGAGGAA
ATGATCGGAAGTTTCTTGAAAAATGGCCCCTTGTGTTATATGGCTTATCGCAATATATTC
CCAATATGGGCTCTTGGAGAGTATCAGAAATTAGTATTTCAGAACTATCAGACCTCTAGC
ATCAAGCAAACAAATATAGCTCCATCTGCTGGCAATGCTGCTCTGAAGAATTCAGCAAGT
ACAACAGCGCCAACTTGA

Protein

786 aa

>Os08t0223900-01 Bicyclic triterpene poaceatapetol synthase, Pollen coat formation
MWKLKIAEGGPWLKSGNSHVGRETWEFDPNFGTSEEREAVEAARIEFQKNRFRTRHTSDV
LARMQLAKANNFSIDLQKEKDGNPINIDTATVSDILKKALSYFSAIQAYDGHWPGDFPGP
LFTTATMIIVLYVTESLTITLSSEHHKEICRYLYNRQNIDGGWGLHAEGESSMLSTALNY
TALRLLGENVDDGPDISMHKARKWIHDHGGATMIPILGKVWLSVLGVFDWSGVNPIPPEL
FLLPSFVPIQPGRLWSHFRMAFIPMSYLYGKKFVGPITRLVISLREELHIHPYKKIDWKE
ARKLCAKEDAYNPHMWLQECLSDCLYSFGEPFLTRWPISYMRKRALYQIAEFLKYEDENS
QYICIGAAQKALSMLCCWIENPNSDAFKRHLARVADFLWVGEDGMKVRVCAGQLWDVAFA
VQAILACSIAEEFGSTLKKAHGFIKTSQIMDNPSGDFSRKYRHISKGGWAFQVADQGWQV
SDCTAEALKALLLLSKCLSDGADYQMETYCYFDAVNVLLSLQNPNGGYGAWELARTYPWM
EIFNMTEIYADIIVEHQYVECTSSVIQALALFREKYPGHRKDEIDQCIRKATEFIEKLQN
DDGSWFGSWGICFTYGTWFAIEGLSAVGQCYDDSTCIRKACKFLLSKQLTNGGWGESHLS
SRTKAYTNLDGEKSHIVNTAWAMLALMKAGQVERDPAPLHKAARLIMSMQLSDGDFPQEE
MIGSFLKNGPLCYMAYRNIFPIWALGEYQKLVFQNYQTSSIKQTNIAPSAGNAALKNSAS
TTAPT*

5'UTR

chr08:7540127..7540131 (+ strand) : 5 bp

CDS

chr08:7540132..7540326 (+ strand) : 195 bp

chr08:7540576..7540761 (+ strand) : 186 bp

chr08:7540884..7540973 (+ strand) : 90 bp

chr08:7541091..7541288 (+ strand) : 198 bp

chr08:7541626..7541710 (+ strand) : 85 bp

chr08:7542101..7542267 (+ strand) : 167 bp

chr08:7542592..7542780 (+ strand) : 189 bp

chr08:7543525..7543638 (+ strand) : 114 bp

chr08:7543733..7543852 (+ strand) : 120 bp

chr08:7543932..7544054 (+ strand) : 123 bp

chr08:7544559..7544657 (+ strand) : 99 bp

chr08:7545077..7545133 (+ strand) : 57 bp

chr08:7545614..7545660 (+ strand) : 47 bp

chr08:7545733..7545876 (+ strand) : 144 bp

chr08:7546370..7546547 (+ strand) : 178 bp

chr08:7547005..7547085 (+ strand) : 81 bp

chr08:7547268..7547351 (+ strand) : 84 bp

chr08:7547758..7547958 (+ strand) : 201 bp

3'UTR

chr08:7547959..7547972 (+ strand) : 14 bp

FASTA

>Os08t0223900-01 class=Sequence position=chr08:7540127..7547972 (+ strand)
ACAATATGTG GAAGCTCAAG ATTGCCGAGG GAGGACCATG GCTAAAGAGT GGAAACAGTC ATGTTGGAAG AGAAACATGG
GAATTTGACC CAAATTTTGG AACAAGTGAA GAGCGGGAGG CGGTTGAGGC TGCACGGATA GAGTTCCAGA AGAATAGGTT
CAGAACAAGA CACACCTCCG ATGTTTTGGC TCGCATGCAG GTATAATGAA AACTTAAGTT CAACTATTGC AAAGAGCTTG
ATTCGTACCT CAAATCAGAC CGCAGCAGCA TCTGTATAGC TCTATAAGAA ACTCACGCCA GTCCTTGTAA CACCTGACAT
TAGCCACAAG CATATGCATT TATAGATGTG TAAACAAGCA TGAAACTAAT CCTGAAAAAC AAAACTAAAC AGCAAAGGGA
ACAGCACAAT ATGATGTTTA GTATCCATCT GGAATTTTCA TTTTTGCAGT TAGCTAAGGC GAACAACTTC AGTATTGATC
TACAGAAAGA AAAAGATGGA AACCCCATAA ATATTGACAC AGCTACAGTA TCAGATATAC TGAAGAAGGC ACTCAGTTAT
TTCTCAGCCA TACAGGCATA TGATGGGCAC TGGCCAGGGG ATTTCCCAGG CCCACTGTTT ACCACTGCAA CCATGGTAAG
ATAGTAACAT ACACAATCAA CTTCATGTCT CCTGGGATTA CCATCATATC ATACATCAAG TTTCCAGCAT CAATTCAATT
TGACAGGGAT CCTTATGTTT GTTTGTTCCA ACTGCAGATC ATAGTTCTAT ATGTCACAGA GTCATTAACT ATTACACTGT
CATCGGAACA TCACAAGGAG ATCTGTCGAT ATCTGTACAA TCGTCAGGTA ACACTCAATA GTTAACAGGA AGTTAATGGC
TACTTTTTAA GTAAATACAC CTAAAAGATT AATTATATTT CATATAAGAT GTGAACAAGA CTTAACTCAA AGTTTGTGAA
CCAGAACATC GATGGAGGAT GGGGACTACA TGCAGAAGGT GAAAGTTCCA TGCTTAGCAC AGCTCTCAAT TATACTGCTC
TGAGACTACT TGGGGAGAAT GTTGATGATG GACCAGATAT ATCCATGCAT AAAGCAAGAA AATGGATACA TGACCATGGA
GGTGCAACAA TGATACCGAT CTTGGGAAAA GTGTGGCTCT CGGTAACAAT ACTTTCAGCT GTATCCTAGT TCTATACTCA
AATACGTTTT CAGCTAGTAA TTTTACTAAG GTGGCTTGGG ATCTCAAGTT TCCACAAGTT AGTTTAATTT ATCAAATATA
ATAATTACCT CACCTGAATT AAAGATCTTT CCACCTACAG AAATCAAATG GTTAATACTA GTCAATGAGA ACATCAAAAT
GATTTGGAAA AGCAAGGTTA TCAAAAGTAT CAAGTATTGT TTTAGTAGTA TGTTAGTTAT GCAAATTTCA TTTGATTATG
GGAGTGGATC TTCCACTATC TACATTCCCC TATTGTAAAC TGTATATTTA ATATTACAGG TGCTTGGAGT TTTTGACTGG
TCAGGTGTAA ATCCTATTCC CCCAGAATTA TTTCTTCTTC CATCTTTCGT TCCTATCCAA CCAGGTAAAA TTTTCTTCCT
TGCTATATGT TCAATTATAT TAGCACAGAT CTTATCACCA GACTTTGAAA TGAAACATGC TAGTTAGAAC ATATAGATTA
TGCTTTAGTT CCTGAGGTCA AGTCGTCTTC TGCAATTACT GAGCAAGAAG TCCACAATAA AGCCCCTATT TAGAGAGATA
TGTTGACAGG AAAATTACAG GTGATCACCA TCATCAATGA TGAAGTGAAC TTCATTAGCA TAAAAAGCAT TATCAATTCA
CTCATTAAAT GTTGATAATT TTGTATTATT CGATTACTTT ATCTTACAGT TGTTCCATCT GTAGAAATAG AGTAGCTATG
TAAAATAGAA CAAATCAAAT ATCATTATGG GTGCAATTTT GTTTTTGTAT GCAGGACGAT TATGGAGTCA CTTCCGAATG
GCTTTTATTC CCATGTCTTA TTTGTATGGA AAAAAGTTTG TCGGTCCTAT AACAAGATTG GTTATATCAT TAAGGGAAGA
GCTACATATT CATCCCTATA AAAAGATTGA CTGGAAGGAG GCACGCAAAT TATGTGCAAA GGTCAGTTCA CTAAACTTAA
CACATTTCTG CCTCGCACGA GAAATTTAGC GAGGTACTCA GCAACAGGTG CTCGCTAGGC CACCTCAGGA ATATTTAGAT
ATAATGCCAA CTAATATTAT GGTCTATGTA TAGACATCTA GATATGTCAG GAATTACTAA CATCATATTA TCAGCTACTA
TGAAATAGAG CTAAGATGTG CTCCAATGCT TGCAATATTC GCATGCTTGT TGTAGTTAAA TATCAGATTG TTTATCAGAA
GATTCAAAGT CCGTATAGCT TGAATCAACT GCAGTAATTT TCTTTCATTG TGAATTCAAA TGTAGGAAGA TGCCTATAAT
CCACATATGT GGCTACAAGA GTGCCTATCT GACTGCCTTT ATAGTTTTGG TGAGCCGTTT CTTACACGTT GGCCAATTTC
CTACATGAGA AAAAGAGCTC TATACCAAAT TGCTGAGTTC TTGAAGTATG AAGATGAAAA TTCTCAGTAT ATCTGCATTG
GTGCTGCACA GAAGGTAGGA GTTCTTCCTT GTCAAAATGA GACTCATACT TACCCTAGAA ATCTCAGAAG AAAAAAAAGC
AGTAATAGCT TCTTATTCTC AGTTTCCTTT TAACAGATTG AGAAGCTGAA TTACCAACTA GTATTTTTGT CCAAAAGTTT
CTCATGAGCC TGCAAATCCT GCATCAACTG CATTCATTTG CTTTACAAGC ATCCCCATGA AACAAGAAGT ACATAGTACA
GAGAACTTGG TTGAAAGTTA AAACTGCATA TCTTTAAAAA AAAGGTCGAG ACTGAATATG CATGTGCAGA GCGCAGACAA
ATGCAAAACA AAATAAGACT TTGATATTTA AAATTAATCA ATTTTCATGG AGATGCAAAA TCTTACACAG ATTGTTAAAT
CGAATACACA TTTAGCATAT ATATAAGGTT TAGCTAAATG TTTATTCTCA GAAAGTGCTT AAAGGTAAAT TTCAGGCTTC
CTTATACATG CATAGTGAAA GACACTATGT TCAGCAGACT TGTTTTTACA GAATGAGTGC ACTTCTGAAA ATGCGTGGTA
AAATTCTAGC ATCATTTACT TCTGAAAATA CATGGTAAAA CTCTAGCACC AATTTTACCA TGTATTTTCA TTAATTGAAC
ACTGCACAGT GCACTCATTC CATAATAATG AGCCTGCTGA ACATAATTTC TTTTTCTATG CATTTCTTTT GACCTGAATT
TTAAGCTCTA GCATGTGAGT GAACATTATT TTGAACAGGC ATTATCCATG TTGTGCTGTT GGATTGAAAA TCCCAATTCA
GATGCATTCA AGCGTCATTT GGCTAGAGTA GCTGATTTTC TATGGGTTGG CGAAGATGGC ATGAAAGTTC GGGTAAATAT
AAGATCAGTT CATTTTATAC ATCTACATCG GATTGCAATA ATTTGTGCGC CAAAATTGGT AAACACAAAC CATTGTCCAT
TCAAAGGTCT GTGCGGGTCA ATTATGGGAT GTTGCTTTCG CAGTCCAAGC GATATTAGCG TGTAGCATCG CAGAAGAATT
TGGAAGTACC CTTAAGAAAG CACATGGTTT CATAAAAACT TCCCAGGTAT TTTTGGCCAG AATTGAAATT ATATTAGTAT
CTTTCTCACA ACTTACTGCT TAACACTACT AACTTAAATT TTAAGATTAT GGACAATCCT TCTGGTGACT TCAGCAGAAA
GTACCGTCAC ATATCTAAAG GAGGATGGGC CTTCCAGGTT GCAGATCAGG GGTGGCAGGT TTCAGATTGC ACAGCAGAAG
CTCTTAAGGT GCAGATCAAA ATTTAAATAT TAAGTGAAGA ACAAATTAGC GCTACCTGAT GCAGACATGG GTCAAGCAGG
GTTGATTTTC CATTTCTATT CATCTGTCTA GGTTTAATTG ATTCTGATTG ATTATTCTCG AAAGTAAAAT GAAAACTGAA
AACAAGAAAA AGGCATGGGT TGATTTTTCC ATTTCTATTC ATCTGTCTGG GTTTAATTGA TTCTGATCGA TTATGCTCGA
AAGTAAAACG AAAACTGAAA ACAAGAAAAA GGCATGGGTT GATTTTCCAA GTCTATATTC ATCTGTCTAG GTTTAATTGA
TTCTGACTGA TAGCTCGAAA GTAAAACCAA AACTGAAAAC AAGAAAATGG AGCATGGCAC ATATGCACCT AAATTCCCCC
CAAATCTGGT GTTAATGTCT TTAAGTTTAC GATACCATCT GATATCATTA TACCATACAT GGAAGATGGA GCACACAAAT
CTACAACAAA GTAATACAGT TTATTGTTTC AGGCTTTGCT ACTGCTGTCA AAGTGTTTGT CAGATGGTGC AGATTATCAA
ATGGAAACCT ACTGCTACTT TGACGCGGTG AATGTATTAC TCTCGTTACA GGTGATTATT CTGCAGCGCA GACAGTACCA
CATACTATAG CATATGATTT GGACAGAGTT CACCTTAAAA AAAAATCTAC TGCCCAAATA ATTCTCTAGT TCCCTAGAAC
ATTAATCATT TATTTTGCTA TCCTATCTGT TACTCCCTCT GTCCCAAAAA AAAAGTAGCT ATTTTTGGTT ATGAAGCCAG
AAATAGCTAC ATTTTTAGGC ACAGGGAGTA GCTAGGAAAG TAAGGGCCCT ATTCTTGAGG TCAAGTACTA TTCATGTCAT
CACGTGAACG GTGAACAGCA CCCATGGGTA CTGTAGAAGT CCAAGTTATC ATATAAAAGG GACCATGAAA CTCCATTGTA
ATTAAAGCAA TGAATAGACA AGAGAAAGGA TAGATGTAGA GTAATAAAGA TTTGACTGAA TTCTATGCAG AACCCAAATG
GTGGGTATGG AGCATGGGAG CTAGCTCGCA CATATCCATG GATGGAGGTA AATCTGCTCA GCACCTCAAC CTAATAACTG
TATCAATGCA CTAAATAGTG TAACTGTAAT GGCCTACGTA TGCTACTATC CTCTTTCTTT ATTATCCTAT TATTTGATTT
AGGAATTATA TGATTAACGC CACTGCATTC TGTTATTGTT ACACATATCT AGAATATACT GTCAGCTCAG AGTTCCAAAC
ATAGAAAAGA AGTGAGAAAA TATTAATGTG TTATTCACAG TCACAAGGCA TACTTCAGAG CATTAGGACT ATCAAAGGTG
AAGGAGAGTA TGCTATGACT TGCAGAATTC ACATTTAGGA TACATAAATA AGAGAATATA ATGGAAGCAA ACTAGCTGAA
TAAGTTAAAT ACTTAGATGG CACATAATAT CAAGGATTTA AGGAAATTAA CGTTAGAGGA GCATGGCAGT AACAAATTAT
ATACATCTGA AGCACTAAAT AATGAGAATT TGAATTACGT TTTGCAGATT TTCAACATGA CAGAGATATA TGCAGACATC
ATTGTGGAGC ATCAGTGAGA ATTTTACAAT CTTTCTTTCT CAAATTCTCC TATTGCAGAA TGCTATAACA TGCACACATA
CTGCAGGTAC GTAGAGTGTA CCTCATCAGT CATCCAAGCA TTGGCATTGT TCCGGGAGAA GTACCCTGGG CATCGGAAAG
ATGAAATAGA TCAATGCATC AGGAAAGCAA CAGAATTCAT CGAGAAGTTA CAGAATGATG ATGGATCATG GTCAGCACTC
CTTAAAAAAA ATACTATAGA AAATTGAAGT ACTAATTAAA TCTATCAATT AACATAATCC TAGTTACATA GGAGAATGAT
GGCATTGCTG GCACACTGCC TCTGTTTAGA GTGCTCTTGC CAAAATCTAA GAGACAGTAT GCCTAATCCG GTGAAACTAA
ATGATTCACC AAATCGCCAA ACAGAATGGG CTAGATCATC ACGTTCTGAG TTGCAACACA TATTTCGGAT TGACAATGTA
CTTATGTACA GATAAGAAAA CAATGAAAAT TGAGATAATA TACAGTAGCA AAGCATATTA AGAGAATCAG TTGCCGATAG
CATTACTAGT AAAGACTTTT GTATAACAGA AAAAAATAGA CTGGATCGAG GTTAAATAAA TTCAATGGTA CATATTAGAT
TTTAAAACAC TGCTACAAGT AAATGTAATA CTGATAGCTG GTTGAGAGAT TGGTAATTTG GATTAATATT TTTTTTTCTA
CAGGTTTGGA TCATGGGGTA TTTGCTTCAC GTATGGAACA TGGTTTGCAA TAGAGGGTCT GTCAGCCGTG GGGCAGTGTT
ATGATGACAG CACCTGCATT CGGAAAGCCT GTAAGTTTCT GTTATCAAAG CAACTAACAA ATGGTGGATG GGGGGAGAGT
CATCTTTCAT CCAGAACCAA GGTAACACTC CCGGAATGCT TTATTGTGTC AATCAACTTT AATTTTTGAC AGCTTAGATT
AAGCATCGGG TTTAGGAAAA CTTCTATCTT TCTTTGTCTT GAAATAAATT GAAGACAAAC AGATAGCATT TTCTAAGAAC
TGGTAATCAG GTAATAACAC TAGGAGCTAA AATCATCCTT AGATTAATTA GCCGACAGGG TCACTCTAGA AAAAAGGACA
AACAAGTAAA TGACATGCAT TAATTGAAAC AAAAACTGAA AAATCAGAAG AGCATGCAAT GTCACTGAAA GAAAATGTAA
TAGCTGATAT TTGACTAATT AGAGGCCATC TGCATCTTTT TTTTCCTTTC ATAATAATTA CAAAACTCCA TTATTTACAA
TATGATTGTT TGAAGTTGGC TTGCATTGCT GTATTTGATT CTTGAGGCTG ATTGTGTGCT ATTTCAAATC ATAAACAGGC
ATACACAAAC CTAGATGGGG AGAAATCACA TATAGTCAAT ACTGCATGGG CAATGTTGGC ACTCATGAAA GCTGGACAGG
TATTACTTCT CTCAGTAAGA ATTTGAAATG GTCAAATTGC AAAGAACGGC AATAGTAATG TGCAGTCAAT GTATGTTTAG
CCCAGAATAA TTCAACCAAT TGTGTAGCTT AAAGACTCAT ATTATATTGG AGTATAATTC AATGCATTTA AGTATTTAAC
CAACTTTTCT TCTGAGTTCA GGTAGAGAGA GACCCCGCTC CTCTGCACAA AGCAGCAAGA CTTATCATGA GCATGCAGCT
CAGTGATGGT GACTTTCCAC AAGAGGTGAC TGCTACATGA CATTTGTATT ATACAATTTG ATGTTAACTC TTGACTTTCC
ATCGTATAAG AAATTTAAGC ATAATGGAAC AATTATTAAA GAGATCTGAG TGAAATTTAA AAAAATAATG TTTAAGTTTC
CTGCAGAACA CCCTAACCAA CCTTTCTATT ACAGGTTTTG GGCAATAGAT GACTCTTGTT ATGAGTTGCT TACTAATAAT
TTACCACTTT TTAGAAATTG TATGGGAAGT TATTTGAAAC TAAACAATGA AATCTGTACT GCATTCCCAT TATTACCCTT
CATATTCTCT AGGAATTGTC CAAATGCTAG CGGGTCATGT AAATAGCCTA AACCCTTAGC ACTCAGTGCT GTTCACACTC
ATTTACTAAT AGTTTATTTG TTTTGCTGTA GGAAATGATC GGAAGTTTCT TGAAAAATGG CCCCTTGTGT TATATGGCTT
ATCGCAATAT ATTCCCAATA TGGGCTCTTG GAGAGTATCA GAAATTAGTA TTTCAGAACT ATCAGACCTC TAGCATCAAG
CAAACAAATA TAGCTCCATC TGCTGGCAAT GCTGCTCTGA AGAATTCAGC AAGTACAACA GCGCCAACTT GATTTCTTGG
CAGAAT