Os08t0237200-01

Locus

Os08g0237200

Description

Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1- phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP- hexose pyrophosphorylase).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMPG4, MPG4, OsVTC1-8, VTC1-8

Oryzabase Gene Name Synonym(s)

mannose-1-phosphate guanyl transferase 4

Transcript Evidence

AK243016 (DDBJ, Best hit)

Protein Evidence

A0EJL9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: transferase activity (GO:0016740)

Molecular Function: nucleotidyltransferase activity (GO:0016779)

Functional domain (InterPro)

Bacterial transferase hexapeptide repeat (IPR001451)

Nucleotidyl transferase (IPR005835)

Hexapeptide transferase, conserved site (IPR018357)

Full-length cDNA

J090098K14 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0237200-01)

Others

Oryzabase (11518)

KEGG (Os08t0237200-01 (EC:2.7.7.13))

Transcript

1812 bp

>Os08t0237200-01 Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1- phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP- hexose pyrophosphorylase).
GCGCGTTAATTCCTCTCCCTCAGTCCCTCTCTCCGGCCCCCTCCTCCCCCACCGGCAACG
CCGCTTCCCCTACCCTTCAGCCAGCGCGCCCTCCCTCTCCCCCCACCGACGACGTCGCTT
CCCCTACCACTCACCCAGGGCGCCCTTCCCTTCCCTTGGCAGCCGGCGTCTCAGCCGCGG
TGCCCTCCCCCTGGCTCCTCGGCGGCGTCCTCACCCTCTTCTCCGCCACAACACAACGGA
CGGTATCGACAGCCTCGGCGGCGGCACCCTCCTCGTAGAAGCGGCGTCCTCGCCTCCCAT
GACCAGTGGCGTCGCTGATTTAGTTTTTTGTTGTGCAGTACTGTGCTGGGCTGGTGGGCT
GCTTCTCCTCCGCTCTGTGGGCTCGCTGGTGGGCTGCGGCTGCTATCTGGGCCGGCCTGC
TGCTGCTTTGGGTGGGCTGCCTCGTCACTAATCCAATCCGGGCTGCTTTGGATGGGCTGC
TCCACAAACAAGGTTCCCCTTCCCAAGCCTTGCTTGAGGATCCCTCCGCCGGAGTAGGGA
TTAGGGAGGGAAGAACAGGAGGCGATTCACCATGAAGGCGCTCATTCTGGTTGGAGGCTT
CGGCACTCGCCTTCGGCCTTTAACGCTCAGTTTCCCAAAGCCTCTTGTTGATTTCGCGAA
CAAGCCCATGATTCTGCATCAGATTGAGGCCTTGAAAGAAGTTGGAGTAACAGAAGTTGT
TTTAGCCATCAACTACCGCCCGGAGGTAATGCTCAATTTCCTGAAGGACTTTGAGGATAA
GCTTGGCATCACAATCACGTGTTCCCAAGAGACTGAGCCCTTGGGAACTGCTGGCCCTCT
TGCTCTAGCAAGGGACAAGCTTGTGGATGGATCTGGTGAGCCATTCTTTGTCCTCAACAG
TGACGTCATAAGTGAATACCCTTTTGCTGAGCTCATAAAATTTCACAAGAACCATGGTGG
TGAGGCAACAATTATGGTCACCAAGGTGGACGAACCATCAAAATATGGTGTTGTGGTTAT
GGAGGAGGCCACTGGAATGGTGGAAAAATTTGTTGAGAAACCAAAAATATTTGTAGGCAA
CAAGATCAATGCAGGAATTTACTTGTTGAACCCGTCTGTCCTGGACCGCATCGAGCTAAA
GCCAACTTCAATTGAGAAAGAGGTCTTTCCTCGAATCTCAGCTGATGCAAAGCTCTTTGC
TATGGTCCTTCCAGGTTTTTGGATGGATGTTGGCCAACCAAGGGATTACATTACAGGCTT
GCGCCTTTATCTGGATTCACTTAGGAAGAGATCAGCCAACAGGTTAGCCACTGGAGCACA
CATTGTTGGGAATGTGCTAGTTCACGAGAGTGCGAAGATTGGCGAAGGCTGTCTGATTGG
TCCTGATGTTGCTATTGGTCCTGGATGCGTCGTGGAGGATGGTGTGAGGCTTTCCCGTTG
CACGGTGATGCGTGGCGTGCGTATTAAGAAGCATGCTTGCATATCAAACAGCATTATTGG
ATGGCACTCAACTGTTGGACAATGGGCACGGATAGAAAATATGACTATCCTAGGAGAGGA
CGTACATGTAGGTGATGAGGTCTATACCAACGGCGGTGTTATTCTCCCGCACAAAGAGAT
CAAATCAAGCATCCTGAAACCTGAGATTGTCATGTGAAATAATCCTTTTTATGTTATGGT
ATACTCAAGTTCTTTTAATGCAGTATAGATACTTTATAATTGTGATCCTTCCAAGATGTT
GACATAGCATGTATGTTACTCACATTCTGATAACTGCTTCTCAATGAGAATTCAGTGAGC
CATATTTGATTG

CDS

1086 bp

>Os08t0237200-01 Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1- phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP- hexose pyrophosphorylase).
ATGAAGGCGCTCATTCTGGTTGGAGGCTTCGGCACTCGCCTTCGGCCTTTAACGCTCAGT
TTCCCAAAGCCTCTTGTTGATTTCGCGAACAAGCCCATGATTCTGCATCAGATTGAGGCC
TTGAAAGAAGTTGGAGTAACAGAAGTTGTTTTAGCCATCAACTACCGCCCGGAGGTAATG
CTCAATTTCCTGAAGGACTTTGAGGATAAGCTTGGCATCACAATCACGTGTTCCCAAGAG
ACTGAGCCCTTGGGAACTGCTGGCCCTCTTGCTCTAGCAAGGGACAAGCTTGTGGATGGA
TCTGGTGAGCCATTCTTTGTCCTCAACAGTGACGTCATAAGTGAATACCCTTTTGCTGAG
CTCATAAAATTTCACAAGAACCATGGTGGTGAGGCAACAATTATGGTCACCAAGGTGGAC
GAACCATCAAAATATGGTGTTGTGGTTATGGAGGAGGCCACTGGAATGGTGGAAAAATTT
GTTGAGAAACCAAAAATATTTGTAGGCAACAAGATCAATGCAGGAATTTACTTGTTGAAC
CCGTCTGTCCTGGACCGCATCGAGCTAAAGCCAACTTCAATTGAGAAAGAGGTCTTTCCT
CGAATCTCAGCTGATGCAAAGCTCTTTGCTATGGTCCTTCCAGGTTTTTGGATGGATGTT
GGCCAACCAAGGGATTACATTACAGGCTTGCGCCTTTATCTGGATTCACTTAGGAAGAGA
TCAGCCAACAGGTTAGCCACTGGAGCACACATTGTTGGGAATGTGCTAGTTCACGAGAGT
GCGAAGATTGGCGAAGGCTGTCTGATTGGTCCTGATGTTGCTATTGGTCCTGGATGCGTC
GTGGAGGATGGTGTGAGGCTTTCCCGTTGCACGGTGATGCGTGGCGTGCGTATTAAGAAG
CATGCTTGCATATCAAACAGCATTATTGGATGGCACTCAACTGTTGGACAATGGGCACGG
ATAGAAAATATGACTATCCTAGGAGAGGACGTACATGTAGGTGATGAGGTCTATACCAAC
GGCGGTGTTATTCTCCCGCACAAAGAGATCAAATCAAGCATCCTGAAACCTGAGATTGTC
ATGTGA

Protein

362 aa

>Os08t0237200-01 Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1- phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP- hexose pyrophosphorylase).
MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM
LNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAE
LIKFHKNHGGEATIMVTKVDEPSKYGVVVMEEATGMVEKFVEKPKIFVGNKINAGIYLLN
PSVLDRIELKPTSIEKEVFPRISADAKLFAMVLPGFWMDVGQPRDYITGLRLYLDSLRKR
SANRLATGAHIVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGVRIKK
HACISNSIIGWHSTVGQWARIENMTILGEDVHVGDEVYTNGGVILPHKEIKSSILKPEIV
M*

5'UTR

chr08:8346228..8346555 (- strand) : 328 bp

chr08:8344938..8345101 (- strand) : 164 bp

chr08:8344140..8344218 (- strand) : 79 bp

CDS

chr08:8344029..8344139 (- strand) : 111 bp

chr08:8343486..8343548 (- strand) : 63 bp

chr08:8343155..8343394 (- strand) : 240 bp

chr08:8342408..8343079 (- strand) : 672 bp

3'UTR

chr08:8342253..8342407 (- strand) : 155 bp

FASTA

>Os08t0237200-01 class=Sequence position=chr08:8342253..8346555 (- strand)
GCGCGTTAAT TCCTCTCCCT CAGTCCCTCT CTCCGGCCCC CTCCTCCCCC ACCGGCAACG CCGCTTCCCC TACCCTTCAG
CCAGCGCGCC CTCCCTCTCC CCCCACCGAC GACGTCGCTT CCCCTACCAC TCACCCAGGG CGCCCTTCCC TTCCCTTGGC
AGCCGGCGTC TCAGCCGCGG TGCCCTCCCC CTGGCTCCTC GGCGGCGTCC TCACCCTCTT CTCCGCCACA ACACAACGGA
CGGTATCGAC AGCCTCGGCG GCGGCACCCT CCTCGTAGAA GCGGCGTCCT CGCCTCCCAT GACCAGTGGC GTCGCTGATT
TAGTTTTTGT GAGTTAATTT TCCCTGGATG ATTTTGGATT TGTGATTTCG TGATTCATTT TCTATCGTTT ATGTATTGTG
TCTTGGCTCA GATGGATCGA ATTGGGGGAT TAGATTTCTT GGGATCAAAT TCATGATATC TAGGTTAAAT TTGGTATTTT
CGTGCTGTTT TTGGTTGATT GATTAATTTG GGTATCTAGC ACGGGGATTT TTTTTTCCTT GAAGACCGAC TTGGACTCAA
AACATACAGA TGACAGACGA AGCGGACTGA ATTTTTTAAT TAGGGGTAGG TATATGATAG ATTTATATTT TTATTATATT
ATTAATTATA ATATAGGTAG GTAGATATCT ATCTATATCT AATCTATATC TATATCTATA TCTACTAGCA AAATGCCCAT
GCGTTGCATT GGGTGAAGAC AGAAATAGTA ATTAGTGTGT GGGAGCATAA AACCACCAGG TAAATTGAGG TCTTTATAGT
CGAATCGAAT CTTTCTAGTG CAAATAAGAC GCTAACATGA TATAATTATT TGCTGCTCTA AATGCACTGA CATGGATACT
AAAGTTTGAA ACCACAAAAA ATATTTACTT TTTTGTCATG TATTATTATG AGTCAATTGC AGTACTTTGT TATTTTTTTG
GTACTCGATA TTGATAAGCA TTTTTTTCAT ATTGTAAAGA GTAGCCATAA TACAAGAAAT AATTTTTTGC TAGCTATCAG
ATCAACCTCA TTGCACTCCA ATTGCATAAC CTTTCACTTA AATAATTAGA AGGAAAGAAA AAAATGTGGT ATATCGCAGA
ATAACTTTCA CTCTAAATAA TAGAAGAAAT TATATAATGA ATGGAAAAAA AAGTGATGTG ATTAGGTGTC CTATGGCGAA
TGAGCAATTG ATGAGGGGAA AAAAATCCAA ATGTAAACAC GATTCATTTT GTTGGTGATT ACTTCTTTTT TTAAAAAAAG
AAAGACACAT GTGATTATTT TTATTTTAAA AAATAATTTA TTTTGTCGGT AAATAATTCA TTTTATTGGT GACTACATTG
GTGACTACAT GTTTTAAGTA ATAAAATCGC TTCTTTTATT ATCCGATTCC TGCTTGGCGT GAGTCCAAAC TTTATTCGTG
TTCGGTTGCT ACAGTGTTGT GCAGTACTGT GCTGGGCTGG TGGGCTGCTT CTCCTCCGCT CTGTGGGCTC GCTGGTGGGC
TGCGGCTGCT ATCTGGGCCG GCCTGCTGCT GCTTTGGGTG GGCTGCCTCG TCACTAATCC AATCCGGGCT GCTTTGGATG
GGCTGCTCCA CAAACAAGGT TTTCTCTTTT TATTTTTCTT TTCTCCTTTA TTTGCAGGCG TAAGAGATCG TGGCCACGCT
TTCGGATCAT GGATTAGCGA CGAATTATCG TGTGGGCCCA CTCTTAATGA CGGACGAAAA GATTAACCGG AAGCCTTACT
TATTTTTTAA TTAGGTATAT AGATATCTAT ATCTAATAAA AAAATTCGTA AGGCTTCCAT TAGTCCGCTT CGTCCGTCGT
TTCTATATAG ATATATAGAT ATCCAATAAC TTGATGAGTT TAACGTATCA TACCTTACCC ATAAACCAAA CACAAGATTG
TGGAGATGAT GGGATTTGCT TTGAGATTTG TGATGGAACA CGTGTCACCT GTGGTCGCGA ATTTTCTTTC GCGAGAGCGA
GACACACACA AGTACACAAC CGCATCTCTA CTGTGGGCCC CCTTCCCCTC CTCGCGTCGC CTCTCCACTT CGCCTCTATA
AAGTCCCATC CAATTCTCGA TTCCCAATCT AGCACAGCAC AAAGGCTCCT CCTTCGACCG CAGCTGTGCT ACCTACCTCC
AATGGGGCTG GTCGTGGAGA AGGAAGAGAG ATCTTCCAGG CTGATCCCTT CTATTGGTAC GAAAGCAGCT CACTGGAGCT
TTGCCACGAC CGCGAGCAAT CAAATCGAAA TCTTTCTTTC TTTTTTATTG ATGCTCCAAC CTAGTTTCAC ATTTGATTTT
GTCTGTTGCA ATGGCAGGTT CCCCTTCCCA AGCCTTGCTT GAGGATCCCT CCGCCGGAGT AGGGATTAGG GAGGGAAGAA
CAGGAGGCGA TTCACCATGA AGGCGCTCAT TCTGGTTGGA GGCTTCGGCA CTCGCCTTCG GCCTTTAACG CTCAGTTTCC
CAAAGCCTCT TGTTGATTTC GCGAACAAGC CCATGATTCT GCATCAGGTA ATATGTGGTT TCGCTAGTAC TCTGATGGAG
TAATAAGAGC ACTTAATTTG CAATGCCAAT CGATGAATTG GGCACAAGTT AATTAGTACA GTATTCTTTA CCAACATTCC
AACACTGACA CTGGCCTCTC CATGAAAGGA GGGAGAGGGT GTTAAACTGG TCAAAGAACA TTAATACTAT TTGATTTGTT
TATAACCCCC ACATAAACAT GGTGTAACAA CTAAACATCC ATGATAGGTG GCATTTGCAT GTGATTGAAT GCACCTTTTT
ACTATTCAAC TGTTTCTTTC CTTATCAATT TGGTTACATG ATTTTGGAGA ACTCTTTTGG TATCACACCA AATTTTCTGT
CCTTGAAAAT TCCAATCAGT TATCAAGAGT ACTTCATTTA TATCCAAAAT GTTGGCTCCA GCAAACATGA GCATGAGGAT
TGAGGAGAGT AATGAGCTCT GAATTAAAAG TTTTCTGGTT TATGCAGATT GAGGCCTTGA AAGAAGTTGG AGTAACAGAA
GTTGTTTTAG CCATCAACTA CCGCCCGGAG GTAAAAAGGA GATAATATTT TACTGTTGTC TCATGGTATA AGTATAACTA
TCTTCGCATT CTAATTGGTT TGTTCTGTAT CCGTCTTTTA GGTAATGCTC AATTTCCTGA AGGACTTTGA GGATAAGCTT
GGCATCACAA TCACGTGTTC CCAAGAGACT GAGCCCTTGG GAACTGCTGG CCCTCTTGCT CTAGCAAGGG ACAAGCTTGT
GGATGGATCT GGTGAGCCAT TCTTTGTCCT CAACAGTGAC GTCATAAGTG AATACCCTTT TGCTGAGCTC ATAAAATTTC
ACAAGAACCA TGGTGGTGAG GCAACAATTA TGGTCACCAA GGTAGATCCT TTCTTTGACC ACTTTCTTGG ATTATAAACT
CGTTGATTGT GTATACTGAC TATTATTTCA ATGTAGGTGG ACGAACCATC AAAATATGGT GTTGTGGTTA TGGAGGAGGC
CACTGGAATG GTGGAAAAAT TTGTTGAGAA ACCAAAAATA TTTGTAGGCA ACAAGATCAA TGCAGGAATT TACTTGTTGA
ACCCGTCTGT CCTGGACCGC ATCGAGCTAA AGCCAACTTC AATTGAGAAA GAGGTCTTTC CTCGAATCTC AGCTGATGCA
AAGCTCTTTG CTATGGTCCT TCCAGGTTTT TGGATGGATG TTGGCCAACC AAGGGATTAC ATTACAGGCT TGCGCCTTTA
TCTGGATTCA CTTAGGAAGA GATCAGCCAA CAGGTTAGCC ACTGGAGCAC ACATTGTTGG GAATGTGCTA GTTCACGAGA
GTGCGAAGAT TGGCGAAGGC TGTCTGATTG GTCCTGATGT TGCTATTGGT CCTGGATGCG TCGTGGAGGA TGGTGTGAGG
CTTTCCCGTT GCACGGTGAT GCGTGGCGTG CGTATTAAGA AGCATGCTTG CATATCAAAC AGCATTATTG GATGGCACTC
AACTGTTGGA CAATGGGCAC GGATAGAAAA TATGACTATC CTAGGAGAGG ACGTACATGT AGGTGATGAG GTCTATACCA
ACGGCGGTGT TATTCTCCCG CACAAAGAGA TCAAATCAAG CATCCTGAAA CCTGAGATTG TCATGTGAAA TAATCCTTTT
TATGTTATGG TATACTCAAG TTCTTTTAAT GCAGTATAGA TACTTTATAA TTGTGATCCT TCCAAGATGT TGACATAGCA
TGTATGTTAC TCACATTCTG ATAACTGCTT CTCAATGAGA ATTCAGTGAG CCATATTTGA TTG

Locus: Os08g0237200

Loading...

Locus: Os08g0237200

Loading...