Os08t0244400-01

Locus

Os08g0244400

Description

SET domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET29

Oryzabase Gene Name Synonym(s)

SET protein 29

Transcript Evidence

AK103017 (DDBJ, Best hit)

Protein Evidence

NP_001151788.1 (RefSeq)

Literature

Note

Manual Curation

Full-length cDNA

J033116N08 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0244400-01)

RiceXPro (AK103017)

Others

Oryzabase (13393)

KEGG (Os08t0244400-01)

Transcript

1499 bp

>Os08t0244400-01 SET domain containing protein.
ACTTACGGCCCAAACAAGGCCCAAAAGGTTTCTGCTTTCAGCCTTCTTCATGCCAAAACC
CCAATCCGGCCGGCGACTCTCCGACATCccggccggcgaccatggcggcggcggcggcgg
aggtagcagcagcgggaggaggaggaGAGATGGTGGTCGTCCGCCTGCCTCCCCTTTCCC
AGGACGACCCCCTCTTCCAAGACAAGAAGAGGATATTGGACAGTAGAAACTTATCCTGTC
TATTTCAAGTTCCAAACTCATGTTCTGCTGCTGATGCCTTCAAAGTACTGGATAGGATAA
TCCAAGCTGCTAGGATAGCTCATATGGATGAGCTTGAGCTTTATTTTACTGGAGACGATG
ATTTCGGGCCATTATCTACAAGGAATGAACTTGAATCTCTAAATTTGTTGCTCAAAATTT
TGAACACGTTGCTTCTGACTGCCAATGTTGGTGCCATGGGAGTTTTGCAAGTCCTACGTG
ATGAAATACTTATTAGGCTCAGATCTCTTGAGTTGGAAGACAATGACCAAATGGTAGTTC
AAATACGAAACCAGAACATGGAAGATTCTCTTCTGAAATGGGGGGAGCAACATGGTGTTA
AAACTAAATTGCAAATAGCATTTTTTGAAGGAGCTGGGAGAGGAATGGTAGCTTCTGAAA
ACATAGATGTGGGGGATATTGCACTTGAAATTCCAGAGTCTTCTATCATATCTGAGGAAC
TTCTCTGCCAGTCTGGCATGTTTCTTGCATTAAAAGATTTAGATAGCATCACCACTGAGA
CTATGCTATTGTTGTGGAGCATCAGAGAGCGGTACAATCCATCTTCAAAGTTTAAGATAT
ACTTCGAGGCACTCCCAGCAAATTTCAATACAGGGCTGAGTTTTGGAATTGATGCACTTG
CTGCATTGGAAGGAACCCTTCTTTTTGATGAGTTAATGCAAGCTAGGCAGCATTTGCGCC
AGCAGTATGATGAGTTATTTCCAATGCTGTGCATAAAGTTTCCTGATATATTCAAACAAG
ACGTGTATACCTGGGACAATTTTCTATGGGCATGTGAATTATGGTATTCTAACAGTATGA
TGGTTGTATTAAGTAGTGGGAAATTAACAACTTGCTTGATTCCTATTGCCGGACTTCTGA
ACCACTCGGTTTCTCCTCACATTCTTAACTATGGTCGGGTAGATAAAGTTACGAAATCTT
TGAAATTTCCTCTGTCTAGACCATGCAAAGCAGGGGAGCAATGTTTTCTCAGTTATGGGA
AGCATCCAGGATCTCATCTTATCACTTTCTATGGTTTTCTACCAAGAGACAACCCTTATG
ATGTTATACCTTTAGATCTTGATACATCTGTGGATGAAGAAGACAGTTCATCTCCGTCCG
TAACTACAAGCCAAACCAGTCATATGGTACGTGGGACATGGCTGTCCAGATTAAGAGGAC
CTCCGACGTATGGGCTGCCTCATCGCTTGGTATCCCATCTCCATGCCATTCTAGGTTGT

CDS

1398 bp

>Os08t0244400-01 SET domain containing protein.
atggcggcggcggcggcggaggtagcagcagcgggaggaggaggaGAGATGGTGGTCGTC
CGCCTGCCTCCCCTTTCCCAGGACGACCCCCTCTTCCAAGACAAGAAGAGGATATTGGAC
AGTAGAAACTTATCCTGTCTATTTCAAGTTCCAAACTCATGTTCTGCTGCTGATGCCTTC
AAAGTACTGGATAGGATAATCCAAGCTGCTAGGATAGCTCATATGGATGAGCTTGAGCTT
TATTTTACTGGAGACGATGATTTCGGGCCATTATCTACAAGGAATGAACTTGAATCTCTA
AATTTGTTGCTCAAAATTTTGAACACGTTGCTTCTGACTGCCAATGTTGGTGCCATGGGA
GTTTTGCAAGTCCTACGTGATGAAATACTTATTAGGCTCAGATCTCTTGAGTTGGAAGAC
AATGACCAAATGGTAGTTCAAATACGAAACCAGAACATGGAAGATTCTCTTCTGAAATGG
GGGGAGCAACATGGTGTTAAAACTAAATTGCAAATAGCATTTTTTGAAGGAGCTGGGAGA
GGAATGGTAGCTTCTGAAAACATAGATGTGGGGGATATTGCACTTGAAATTCCAGAGTCT
TCTATCATATCTGAGGAACTTCTCTGCCAGTCTGGCATGTTTCTTGCATTAAAAGATTTA
GATAGCATCACCACTGAGACTATGCTATTGTTGTGGAGCATCAGAGAGCGGTACAATCCA
TCTTCAAAGTTTAAGATATACTTCGAGGCACTCCCAGCAAATTTCAATACAGGGCTGAGT
TTTGGAATTGATGCACTTGCTGCATTGGAAGGAACCCTTCTTTTTGATGAGTTAATGCAA
GCTAGGCAGCATTTGCGCCAGCAGTATGATGAGTTATTTCCAATGCTGTGCATAAAGTTT
CCTGATATATTCAAACAAGACGTGTATACCTGGGACAATTTTCTATGGGCATGTGAATTA
TGGTATTCTAACAGTATGATGGTTGTATTAAGTAGTGGGAAATTAACAACTTGCTTGATT
CCTATTGCCGGACTTCTGAACCACTCGGTTTCTCCTCACATTCTTAACTATGGTCGGGTA
GATAAAGTTACGAAATCTTTGAAATTTCCTCTGTCTAGACCATGCAAAGCAGGGGAGCAA
TGTTTTCTCAGTTATGGGAAGCATCCAGGATCTCATCTTATCACTTTCTATGGTTTTCTA
CCAAGAGACAACCCTTATGATGTTATACCTTTAGATCTTGATACATCTGTGGATGAAGAA
GACAGTTCATCTCCGTCCGTAACTACAAGCCAAACCAGTCATATGGTACGTGGGACATGG
CTGTCCAGATTAAGAGGACCTCCGACGTATGGGCTGCCTCATCGCTTGGTATCCCATCTC
CATGCCATTCTAGGTTGT

Protein

466 aa

>Os08t0244400-01 SET domain containing protein.
MAAAAAEVAAAGGGGEMVVVRLPPLSQDDPLFQDKKRILDSRNLSCLFQVPNSCSAADAF
KVLDRIIQAARIAHMDELELYFTGDDDFGPLSTRNELESLNLLLKILNTLLLTANVGAMG
VLQVLRDEILIRLRSLELEDNDQMVVQIRNQNMEDSLLKWGEQHGVKTKLQIAFFEGAGR
GMVASENIDVGDIALEIPESSIISEELLCQSGMFLALKDLDSITTETMLLLWSIRERYNP
SSKFKIYFEALPANFNTGLSFGIDALAALEGTLLFDELMQARQHLRQQYDELFPMLCIKF
PDIFKQDVYTWDNFLWACELWYSNSMMVVLSSGKLTTCLIPIAGLLNHSVSPHILNYGRV
DKVTKSLKFPLSRPCKAGEQCFLSYGKHPGSHLITFYGFLPRDNPYDVIPLDLDTSVDEE
DSSSPSVTTSQTSHMVRGTWLSRLRGPPTYGLPHRLVSHLHAILGC

5'UTR

chr08:8816599..8816699 (- strand) : 101 bp

CDS

chr08:8816491..8816598 (- strand) : 108 bp

chr08:8815493..8815615 (- strand) : 123 bp

chr08:8815094..8815382 (- strand) : 289 bp

chr08:8814467..8814585 (- strand) : 119 bp

chr08:8814022..8814154 (- strand) : 133 bp

chr08:8813870..8813946 (- strand) : 77 bp

chr08:8813588..8813785 (- strand) : 198 bp

chr08:8813312..8813498 (- strand) : 187 bp

chr08:8812892..8813055 (- strand) : 164 bp

FASTA

>Os08t0244400-01 class=Sequence position=chr08:8812892..8816699 (- strand)
ACTTACGGCC CAAACAAGGC CCAAAAGGTT TCTGCTTTCA GCCTTCTTCA TGCCAAAACC CCAATCCGGC CGGCGACTCT
CCGACATCcc ggccggcgac catggcggcg gcggcggcgg aggtagcagc agcgggagga ggaggaGAGA TGGTGGTCGT
CCGCCTGCCT CCCCTTTCCC AGGACGACCC CCTCTTCCAA GACAAGAAGG TACCGTACCA TACACACGAG CGAGCGCGAG
GAAGAGAATC TCTGCCACGA TAGTTTGTTC TTGTGTTCAT CTAGGATTTG GTTTCAAAGG GATTTCTCTT GTTCTGTGTT
TACTTCACTC GTGGTAAGAA GGTAGGAGCA GCAGATGGAG AAAAAAGAAA TAGGCCCCCT TTTATCCGCT GGTTTGGATC
TTGCGAAATG TTTTGGTTAA GTTAGCTTTA GTCGATGCCA TGCTTGATAT AGTGTAAATC ATTACTACCA TTGCAATTAT
GAATGTTCGA ATTAGTGAAT TAGGGATTTT GACAGGGTAT GGAGTTTCTT TTGCGTTGCT CTTCCCGCAT ACCCCGGTTT
GTTGCGTTCC TACATGAAGA TGATAAGTTC ACTTTTAGTT GATTTATTTA AGAGGCAGTT AATCTAGAAA ATTTGGAAAA
ATGTTGATAT ATTCCACTTG AAGTGTTTTT AGTTTTCATT GGTTGAGTTA AATCTTTGAA AGTTGAACAA ATACACAAGT
GGCAAGGAAG AAAAGCAGAT GCTCTTATCT TTTGTAATAC CATACAATAT CTTCtactcc ctccgtttca ggttataaga
ctttctagcg ttgcctatat tcatatagat gttaatgaat ataggcacat atatatgtct agattcagta acatatatat
gaatatgggc aatgctagaa agtcttataa tatgaaacgg aggaagtaGC TTATATTACA GTTCTAAAAT CTCATGTGGA
AGGTCAAGTA GATGAATTAA CACATGTTTA GTTTCTCCGT TTGTTTGATT CTCATGCCCG TTGGAATCTG CAGCTGCAGA
CATCTCGAAA AATTTTAGTA AGTTCATTTC TTATATAAAT GCAGAGGATA TTGGACAGTA GAAACTTATC CTGTCTATTT
CAAGTTCCAA ACTCATGTTC TGCTGCTGAT GCCTTCAAAG TACTGGATAG GATAATCCAA GCTGCTAGGA TAGCTCATAT
GGATGAGGTA TTACATGTTT TATCCTTCAC TATTCTTTTG GAAATAAGAG AAAAAGGTTC TAGAGTATTA CTCTGTTCTA
ATATCTGACA AATTTAGTTT GCATTGATTT CCTACAGCTT GAGCTTTATT TTACTGGAGA CGATGATTTC GGGCCATTAT
CTACAAGGAA TGAACTTGAA TCTCTAAATT TGTTGCTCAA AATTTTGAAC ACGTTGCTTC TGACTGCCAA TGTTGGTGCC
ATGGGAGTTT TGCAAGTCCT ACGTGATGAA ATACTTATTA GGCTCAGATC TCTTGAGTTG GAAGACAATG ACCAAATGGT
AGTTCAAATA CGAAACCAGA ACATGGAAGA TTCTCTTCTG AAATGGGGGG AGCAACATGG TGTTAAAACT AAATTGCAAA
TAGCATGTAA GTGTCCAGAC AAGTCTCAGA TAGTGTGCCA CACTCTCCAT TCTTTACTAT TATGGATCAT GATTGCTCCA
TGCTGAATCC TACTCATTTA TACTTGAGAA GCTTTCTGTC TTTTACACTG GAATGTAGAA ACAAGAAAAA AAAACTGATG
ACAAGAAAAT CTGGATGATA CAATCTTTCT ATGTATAATA AAGTTTCTCC TGTGTTTTGA TAATCAAGAA TTTTCTGATT
GTTTTTGAAA TATTTGTGTT GCTGTGGTAT TTATGACCAT GCTATAGGCT GTATAATAGA CAAGTTGATA TTAGTTAATT
TAGTTGAATT ATTAATGGTA GATGATGCAG AAATGCTAGA GGTGTGTTTG TTCACTGTAT ATCAGGATTC TTAGTTATTT
ACTCCATTTT TCCCCATATA ACCAATTTTA GTTAACTACT AATTGATGTG AGCATGTGAC AATTGATGTT TTATATAATT
AATTATACAT ATGTTTATCT GATTGAAATT TTAGTTTTTG AAGGAGCTGG GAGAGGAATG GTAGCTTCTG AAAACATAGA
TGTGGGGGAT ATTGCACTTG AAATTCCAGA GTCTTCTATC ATATCTGAGG AACTTCTCTG CCAGTCTGGC ATGGTATGAA
CTTCCTTGGT AATCCTATTT CCACATTTCA TAAGCACCCA CTATTCCCTT CTGGTGGCAG AAACTAGTTC TGGCTAGCAT
GGAACCCTCT GGGAAACTAA AAATTGCATT TTTACTTTCC CATATTTTCA GTTTGATTGT CAAAGTGAAG CTATCTGACT
CGGTTAAATT GAAACACGTA CGCTTGGCAT ATTATATGAA GTGCAGATTA TGAAAAGATT ACTGCTGAAA CTCTTGTAGA
TAGACCGATG TTTTGACATT TACTTCCTTG GTCATCATTT ATAGATATGT TTCTATGATT TGCAGTTTCT TGCATTAAAA
GATTTAGATA GCATCACCAC TGAGACTATG CTATTGTTGT GGAGCATCAG AGAGCGGTAC AATCCATCTT CAAAGTTTAA
GATATACTTC GAGGCACTCC CAGCAAATTT CAATACAGGT ATTTGTAGTT CATTCTCTTC TGAAAGAAAC TCTATTTTCA
TCTTAAATTC ATTTCATCTG TATGAATTTC CAGGGCTGAG TTTTGGAATT GATGCACTTG CTGCATTGGA AGGAACCCTT
CTTTTTGATG AGTTAATGCA AGCTAGGCAG GCAATATACT GTTATGGTAT TGTTATATTA ATTCTTCAGA TCACTATTCA
ACTGGTATGA CCTGTTAGTT ATCTTTTGTT TCAGCATTTG CGCCAGCAGT ATGATGAGTT ATTTCCAATG CTGTGCATAA
AGTTTCCTGA TATATTCAAA CAAGACGTGT ATACCTGGGA CAATTTTCTA TGGGCATGTG AATTATGGTA TTCTAACAGT
ATGATGGTTG TATTAAGTAG TGGGAAATTA ACAACTTGCT TGATTCCTAT TGCCGGACTT CTGAACCACT CGGTTTGCAA
CTTTATCCCT GAATTGATTC CAAAATTTTC TTTTAATGGT CCACAGGTTT CTGTCTCATG CCTTACTTTT TTTTTCTGTA
GGTTTCTCCT CACATTCTTA ACTATGGTCG GGTAGATAAA GTTACGAAAT CTTTGAAATT TCCTCTGTCT AGACCATGCA
AAGCAGGGGA GCAATGTTTT CTCAGTTATG GGAAGCATCC AGGATCTCAT CTTATCACTT TCTATGGTTT TCTACCAAGA
GACAACCCTT ATGATGTTAT ACCTTTAGGT AATGTGTAGA TTTCTACTTA AGTAGTGATG TTTCCCTTGC TTTTCTTGTC
ATGGCGATGG TGGAGGAGCT GGATTTCTTA ACACTGTGTT CTTACTAAAG GGCTTAGCTT GATGATCCTA TTTTGATCTA
ACAACCTCTT GGCTTTCAAT TGTGGAGCAC CGGGGACAAT TTCGATGAAT GATGATGACT CTTAAGCATT CTGTAAATTC
AAGTAAATAT AGACATAACA TTGTTAGGAT GTGATTGTCT ACAGATCTTG ATACATCTGT GGATGAAGAA GACAGTTCAT
CTCCGTCCGT AACTACAAGC CAAACCAGTC ATATGGTACG TGGGACATGG CTGTCCAGAT TAAGAGGACC TCCGACGTAT
GGGCTGCCTC ATCGCTTGGT ATCCCATCTC CATGCCATTC TAGGTTGT

Locus: Os08g0244400

Loading...

Locus: Os08g0244400

Loading...