Os08t0244400-02

Locus

Os08g0244400

Description

Similar to SET domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET29

Oryzabase Gene Name Synonym(s)

SET protein 29

Transcript Evidence

AK072666 (DDBJ, Best hit)

Protein Evidence

NP_001151788.1 (RefSeq)

Literature

Note

Manual Curation

Full-length cDNA

J023134A15 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0244400-02)

RiceXPro (AK072666)

Others

Oryzabase (13393)

KEGG (Os08t0244400-02)

Transcript

1287 bp

>Os08t0244400-02 Similar to SET domain containing protein.
CATGCCTTACTTTTTTTTTCTGTAGGTTTCTCCTCACATTCTTAACTATGGTCGGGTAGA
TAAAGTTACGAAATCTTTGAAATTTCCTCTGTCTAGACCATGCAAAGCAGGGGAGCAATG
TTTTCTCAGTTATGGGAAGCATCCAGGATCTCATCTTATCACTTTCTATGGTTTTCTACC
AAGAGACAACCCTTATGATGTTATACCTTTAGATCTTGATACATCTGTGGATGAAGAAGA
CAGTTCATCTCCGTCCGTAACTACAAGCCAAACCAGTCATATGGTACGTGGGACATGGCT
GTCCAGATTAAGAGGACCTCCGACGTATGGGCTGCCTCATCGCTTGGTATCCCATCTCCA
TGCCATTCTAGGTTGTAATCAGAACGAATCCGCTCCAGAGGCTGATAACAAGGAAAATGA
CAGGATGGTGCTCGAAACACTCCTCTCCATATTTACTCCCATGCTTGAAGGATTAGGCGA
ACCAGATGACTTCGACCGGGAGAACGCATGTTGGGACGTCAATCTCGCACTGGACTACAA
AGATCTACAAAGAAGGATAGTTTTGTCCATTGTTACTTCGTGTACCTCAGGCTTGGCCAT
GCTTGATTCCTAGTCCGAACTCTTTAGTGCTTCATCATTGGATGTGCAAGACCACAATTG
GAGTTTGTTGGGAGTGACTCAAGCTGACATGTGGATGGTGGAGCTGTTGCACATGGGTTA
CCTGCAACTGACTGCAAATCTGTTCTTTCCTGGATAGGGATCCAAGGACCAGTATGGCAT
TTGACCACCAGTCCCAAGTGAAGATGCTCAGCTCACAGCATCAGATGTCTGATCCGATGA
TTACGCGAAATCCAGTCATCGATCTGTGCCCTCTGTGGCTTGAGATTTAAGTAAGTTGCC
CCTGGTTGTTACTGCAAACCTGCTGCTTTTGGTGGAAGAAAGCTACTTCTGAACTAATTT
ATTGGGGATGGAGTAATGTCTCTTCGACCCATAACGCCGACATTTCAGCTTATTATTTAT
AAGATCATATTGCTGATCATGGAACTGCACATGGAATTTCTGCTAAATTAGTTTTCTCCC
ATGTGGTCCATATGCTAGAATAACTGAACACTGCATAAAAGGATGCTCCTTGAGTTGTGT
GCTGAACCTGCTAGTTTTTTTCCCTTTTCTTTTCCTTGAGTTGTGTACTGAACCTGCTAG
TTTTTTATTTTTCTTTTTTTTCCTTGAGTTATGAACTGTGCCTGTtacttcctctatttc
atattataagtcactttgggtttgcgc

CDS

588 bp

>Os08t0244400-02 Similar to SET domain containing protein.
GTTTCTCCTCACATTCTTAACTATGGTCGGGTAGATAAAGTTACGAAATCTTTGAAATTT
CCTCTGTCTAGACCATGCAAAGCAGGGGAGCAATGTTTTCTCAGTTATGGGAAGCATCCA
GGATCTCATCTTATCACTTTCTATGGTTTTCTACCAAGAGACAACCCTTATGATGTTATA
CCTTTAGATCTTGATACATCTGTGGATGAAGAAGACAGTTCATCTCCGTCCGTAACTACA
AGCCAAACCAGTCATATGGTACGTGGGACATGGCTGTCCAGATTAAGAGGACCTCCGACG
TATGGGCTGCCTCATCGCTTGGTATCCCATCTCCATGCCATTCTAGGTTGTAATCAGAAC
GAATCCGCTCCAGAGGCTGATAACAAGGAAAATGACAGGATGGTGCTCGAAACACTCCTC
TCCATATTTACTCCCATGCTTGAAGGATTAGGCGAACCAGATGACTTCGACCGGGAGAAC
GCATGTTGGGACGTCAATCTCGCACTGGACTACAAAGATCTACAAAGAAGGATAGTTTTG
TCCATTGTTACTTCGTGTACCTCAGGCTTGGCCATGCTTGATTCCTAG

Protein

196 aa

>Os08t0244400-02 Similar to SET domain containing protein.
VSPHILNYGRVDKVTKSLKFPLSRPCKAGEQCFLSYGKHPGSHLITFYGFLPRDNPYDVI
PLDLDTSVDEEDSSSPSVTTSQTSHMVRGTWLSRLRGPPTYGLPHRLVSHLHAILGCNQN
ESAPEADNKENDRMVLETLLSIFTPMLEGLGEPDDFDRENACWDVNLALDYKDLQRRIVL
SIVTSCTSGLAMLDS*

5'UTR

chr08:8813499..8813523 (- strand) : 25 bp

CDS

chr08:8813312..8813498 (- strand) : 187 bp

chr08:8812862..8813055 (- strand) : 194 bp

chr08:8812659..8812750 (- strand) : 92 bp

chr08:8812449..8812563 (- strand) : 115 bp

3'UTR

chr08:8811775..8812448 (- strand) : 674 bp

FASTA

>Os08t0244400-02 class=Sequence position=chr08:8811775..8813523 (- strand)
CATGCCTTAC TTTTTTTTTC TGTAGGTTTC TCCTCACATT CTTAACTATG GTCGGGTAGA TAAAGTTACG AAATCTTTGA
AATTTCCTCT GTCTAGACCA TGCAAAGCAG GGGAGCAATG TTTTCTCAGT TATGGGAAGC ATCCAGGATC TCATCTTATC
ACTTTCTATG GTTTTCTACC AAGAGACAAC CCTTATGATG TTATACCTTT AGGTAATGTG TAGATTTCTA CTTAAGTAGT
GATGTTTCCC TTGCTTTTCT TGTCATGGCG ATGGTGGAGG AGCTGGATTT CTTAACACTG TGTTCTTACT AAAGGGCTTA
GCTTGATGAT CCTATTTTGA TCTAACAACC TCTTGGCTTT CAATTGTGGA GCACCGGGGA CAATTTCGAT GAATGATGAT
GACTCTTAAG CATTCTGTAA ATTCAAGTAA ATATAGACAT AACATTGTTA GGATGTGATT GTCTACAGAT CTTGATACAT
CTGTGGATGA AGAAGACAGT TCATCTCCGT CCGTAACTAC AAGCCAAACC AGTCATATGG TACGTGGGAC ATGGCTGTCC
AGATTAAGAG GACCTCCGAC GTATGGGCTG CCTCATCGCT TGGTATCCCA TCTCCATGCC ATTCTAGGTT GTAATCAGAA
CGAATCCGCT CCAGAGGCTG ATGTAAGGAT GTTTCTTTAT TCTTCCTGAA TGGTGTGTGA AGCATGCCAT ATGCATGACA
AAGACCCCAA AAATGAGACC TGCAGCTAAC CCCAATCACT TGTCCGTACT CAGAACAAGG AAAATGACAG GATGGTGCTC
GAAACACTCC TCTCCATATT TACTCCCATG CTTGAAGGAT TAGGCGAACC AGATGACTTC GACCGGTGCT ACCTCATGCT
TAAACACCTC CTTTATCACT CATGGAGTGC CTGACATCAG CATTGCTTAC ATGCTACTAT CTTTGTTTGG TTTCTTGCAG
GGAGAACGCA TGTTGGGACG TCAATCTCGC ACTGGACTAC AAAGATCTAC AAAGAAGGAT AGTTTTGTCC ATTGTTACTT
CGTGTACCTC AGGCTTGGCC ATGCTTGATT CCTAGTCCGA ACTCTTTAGT GCTTCATCAT TGGATGTGCA AGACCACAAT
TGGAGTTTGT TGGGAGTGAC TCAAGCTGAC ATGTGGATGG TGGAGCTGTT GCACATGGGT TACCTGCAAC TGACTGCAAA
TCTGTTCTTT CCTGGATAGG GATCCAAGGA CCAGTATGGC ATTTGACCAC CAGTCCCAAG TGAAGATGCT CAGCTCACAG
CATCAGATGT CTGATCCGAT GATTACGCGA AATCCAGTCA TCGATCTGTG CCCTCTGTGG CTTGAGATTT AAGTAAGTTG
CCCCTGGTTG TTACTGCAAA CCTGCTGCTT TTGGTGGAAG AAAGCTACTT CTGAACTAAT TTATTGGGGA TGGAGTAATG
TCTCTTCGAC CCATAACGCC GACATTTCAG CTTATTATTT ATAAGATCAT ATTGCTGATC ATGGAACTGC ACATGGAATT
TCTGCTAAAT TAGTTTTCTC CCATGTGGTC CATATGCTAG AATAACTGAA CACTGCATAA AAGGATGCTC CTTGAGTTGT
GTGCTGAACC TGCTAGTTTT TTTCCCTTTT CTTTTCCTTG AGTTGTGTAC TGAACCTGCT AGTTTTTTAT TTTTCTTTTT
TTTCCTTGAG TTATGAACTG TGCCTGTtac ttcctctatt tcatattata agtcactttg ggtttgcgc

Locus: Os08g0244400

Loading...

Locus: Os08g0244400

Loading...