Os08t0248000-00

Locus

Os08g0248000

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

G1L13

CGSNL Gene Name

G1 LIKE PROTEIN 13

Oryzabase Gene Symbol Synonym(s)

OsG1L13

Oryzabase Gene Name Synonym(s)

Transcript Evidence

EU974962 (DDBJ)

Protein Evidence

NP_001078202.2 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Domain of unknown function DUF640 (IPR006936)

Expression Databases

TENOR (Os08t0248000-00)

Others

Oryzabase (22981)

KEGG (Os08t0248000-00)

Transcript

609 bp

>Os08t0248000-00 Similar to predicted protein.
atggcgaggacggtggctggcggagtggagcggggcggcggcggcggtggacgagcgcgc
ggccggcggagccacccctcgctaccggtgccgtgcccgtgccttctccgccaggcgtgg
ggcagcctcaacgcgctcgtcggccgcttccgcgccgcctttgaggagcatggcggccaa
cccgaggccaacccgttcggcgcccgcgccgtccgcctctacctccacgaggtctacgac
tgccaggccaaggcgcgcggcatcgcctacgagaagaagcgttggaaacgcccgcccacc
tcgtcttctcactctcaggccgccgccgccgctacctcctcggcgagccagccgctagcc
cgctgccgccaccgccgttgccggagagatcagccgacgtgggagcttgtgtcgccatcg
ccgtcaccatggggtgcacgccactctcgccagccgcccgccgccgcggctcctatcgcg
cgctcgctcgctgcctcctgccacgcactcgctcgccgccgctgccgctccgccggccgc
gtgctcgtccaccgccgccgccgccccactccactccgctggccgccgttctcaccatct
ccgccgtga

CDS

609 bp

>Os08t0248000-00 Similar to predicted protein.
atggcgaggacggtggctggcggagtggagcggggcggcggcggcggtggacgagcgcgc
ggccggcggagccacccctcgctaccggtgccgtgcccgtgccttctccgccaggcgtgg
ggcagcctcaacgcgctcgtcggccgcttccgcgccgcctttgaggagcatggcggccaa
cccgaggccaacccgttcggcgcccgcgccgtccgcctctacctccacgaggtctacgac
tgccaggccaaggcgcgcggcatcgcctacgagaagaagcgttggaaacgcccgcccacc
tcgtcttctcactctcaggccgccgccgccgctacctcctcggcgagccagccgctagcc
cgctgccgccaccgccgttgccggagagatcagccgacgtgggagcttgtgtcgccatcg
ccgtcaccatggggtgcacgccactctcgccagccgcccgccgccgcggctcctatcgcg
cgctcgctcgctgcctcctgccacgcactcgctcgccgccgctgccgctccgccggccgc
gtgctcgtccaccgccgccgccgccccactccactccgctggccgccgttctcaccatct
ccgccgtga

Protein

202 aa

>Os08t0248000-00 Similar to predicted protein.
MARTVAGGVERGGGGGGRARGRRSHPSLPVPCPCLLRQAWGSLNALVGRFRAAFEEHGGQ
PEANPFGARAVRLYLHEVYDCQAKARGIAYEKKRWKRPPTSSSHSQAAAAATSSASQPLA
RCRHRRCRRDQPTWELVSPSPSPWGARHSRQPPAAAAPIARSLAASCHALARRRCRSAGR
VLVHRRRRPTPLRWPPFSPSPP*

CDS

chr08:9030748..9031356 (- strand) : 609 bp

FASTA

>Os08t0248000-00 class=Sequence position=chr08:9030748..9031356 (- strand)
atggcgagga cggtggctgg cggagtggag cggggcggcg gcggcggtgg acgagcgcgc ggccggcgga gccacccctc
gctaccggtg ccgtgcccgt gccttctccg ccaggcgtgg ggcagcctca acgcgctcgt cggccgcttc cgcgccgcct
ttgaggagca tggcggccaa cccgaggcca acccgttcgg cgcccgcgcc gtccgcctct acctccacga ggtctacgac
tgccaggcca aggcgcgcgg catcgcctac gagaagaagc gttggaaacg cccgcccacc tcgtcttctc actctcaggc
cgccgccgcc gctacctcct cggcgagcca gccgctagcc cgctgccgcc accgccgttg ccggagagat cagccgacgt
gggagcttgt gtcgccatcg ccgtcaccat ggggtgcacg ccactctcgc cagccgcccg ccgccgcggc tcctatcgcg
cgctcgctcg ctgcctcctg ccacgcactc gctcgccgcc gctgccgctc cgccggccgc gtgctcgtcc accgccgccg
ccgccccact ccactccgct ggccgccgtt ctcaccatct ccgccgtga

Locus: Os08g0248000

Loading...

Locus: Os08g0248000

Loading...