Os08t0253800-01

Locus

Os08g0253800

Description

Similar to Cellulose synthase-like family C3 protein (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CSLC3

CGSNL Gene Name

CELLULOSE SYNTHASE LIKE C3

Oryzabase Gene Symbol Synonym(s)

OsCslC3, OsCSLC3

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK108045 (DDBJ, Best hit)

Protein Evidence

C8CBX5 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Glycosyl transferase, family 2 (IPR001173)

Full-length cDNA

002-137-E05 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0253800-01)

Others

Oryzabase (13890)

Transcript

1794 bp

>Os08t0253800-01 Similar to Cellulose synthase-like family C3 protein (Fragment).
ctcatccagatgccaatgtgcaacgagaaagagGTGTATGAGACGTCGATATCGCATGTG
TGCCAGATCGACTGGCCGCGGGAGAGGATGCTGGTGCAAGTGCTGGACGACTCGGACGAC
GAGACGTGCCAGATGCTGATCAAGGCGGAGGTGACCAAGTGGAGCCAGCGCGGCGTCAAC
ATCATCTACCGCCACCGCCTCAACCGCACCGGTTACAAGGCCGGCAACCTCAAGTCCGCC
ATGAGCTGCGACTACGTCCGCGACTACGAGTTCGTCGCCATCTTCGACGCTGACTTCCAG
CCTAACCCCGACTTCCTCAAGCTCACCGTCCCACACTTCAAGggaaacccggagctaggg
ctggtgcaggcgcggtggagcttcgtgaacaaggacgagaacctgctgacccggctgcag
aacataaacctgtgcttccacttcgaggtggagcagcaggtgaatggcgtctacctcagc
ttcttcgggttcaacggcaccgccggcgtgtggcgcatcaaggccctcgaggactccggc
ggctggatggagcggaccaccgtcgaggacatggacatcgccgtccgcgcccacctcaac
ggctggaagttcatcttcctcaacgacgtcaagGTCCTCTGTGAGCTGCCGGAGTCGTAC
CAGGCTTACCGGAAGCAGCAGCACCGGTGGCACTCCGGCCCCATGCAGCTCTTCCGTCTC
TGCCTCCCGGCCGTCTTCAAGTCCAAGatctcgacgtggaagaaggcgaacctggttatg
ctgttcttcctgctgcggaagctgatcctgccattctactcgttcacgctcttctgcgtg
atcctgccgctgaccatgttcgtgccggaggcggagctgccgatctgggtgatctgctac
gtgccggtgatcatgtcggtgctcaacatcctgccggcgcccaagtcgttccccttcgtc
atcccttacctcctcttcgagaacaccatgtccgtcaccaagttcaacgccatggtctcc
ggcctcttccagctggggagctcctacgagtgggtcgtcaccaagaaggccggcaggacc
tcgtcggagtccgacatcctcgccctcgccgaggccgccgacgccgacgcccggccgcca
ccggccaagctccaccgcggcgtctccgagggcggcctcaaggagtgggccaagctgcac
aaggagcaggaggacgccacggcggcggcggcggcggcggcggcgccggggacgccggtg
aagaagagcaaggcggcgaaggctccgaaccggatcttcaagaaggagctcgcgctggcg
ttcctcctcctcaccgccgccacgcgcagcttgctctcggcgcaggggctgcacttctac
ttcctcctcttccagggcgtcaccttcctcgccgtcggcctcgacctcatcggcgagcag
gtCAGCTAGCGACCACCACCACAATAAAGAAAAAAAAGCCACCGCCGCCGCCGCTGCCGC
CGCCATGCGTGCACAGCGCGCCGGCTGGCTGGCCGGAGGCGAAGACGACGACGGCCAGCC
AAGACACTTCCATGGATCGACAGAGGATTACATTTTTAGCCTTCTTCTCCTTATTTTTAT
CCCTTTGATATATTTTTTGTTCAGAGATAAAAAAAACAGAGTGCGTCTCCATGTTACAAA
GAACTCTTCTTTTCTTTGTGCTTTAATTAGCTAGTGCTTTGTTGCTAGGAGAGGCAAGCA
GGCCGCATCAGGTTGTTAATTACATTCAGATTAAGTTGTGTCAATTCAGTAGCC

CDS

1440 bp

>Os08t0253800-01 Similar to Cellulose synthase-like family C3 protein (Fragment).
atgccaatgtgcaacgagaaagagGTGTATGAGACGTCGATATCGCATGTGTGCCAGATC
GACTGGCCGCGGGAGAGGATGCTGGTGCAAGTGCTGGACGACTCGGACGACGAGACGTGC
CAGATGCTGATCAAGGCGGAGGTGACCAAGTGGAGCCAGCGCGGCGTCAACATCATCTAC
CGCCACCGCCTCAACCGCACCGGTTACAAGGCCGGCAACCTCAAGTCCGCCATGAGCTGC
GACTACGTCCGCGACTACGAGTTCGTCGCCATCTTCGACGCTGACTTCCAGCCTAACCCC
GACTTCCTCAAGCTCACCGTCCCACACTTCAAGggaaacccggagctagggctggtgcag
gcgcggtggagcttcgtgaacaaggacgagaacctgctgacccggctgcagaacataaac
ctgtgcttccacttcgaggtggagcagcaggtgaatggcgtctacctcagcttcttcggg
ttcaacggcaccgccggcgtgtggcgcatcaaggccctcgaggactccggcggctggatg
gagcggaccaccgtcgaggacatggacatcgccgtccgcgcccacctcaacggctggaag
ttcatcttcctcaacgacgtcaagGTCCTCTGTGAGCTGCCGGAGTCGTACCAGGCTTAC
CGGAAGCAGCAGCACCGGTGGCACTCCGGCCCCATGCAGCTCTTCCGTCTCTGCCTCCCG
GCCGTCTTCAAGTCCAAGatctcgacgtggaagaaggcgaacctggttatgctgttcttc
ctgctgcggaagctgatcctgccattctactcgttcacgctcttctgcgtgatcctgccg
ctgaccatgttcgtgccggaggcggagctgccgatctgggtgatctgctacgtgccggtg
atcatgtcggtgctcaacatcctgccggcgcccaagtcgttccccttcgtcatcccttac
ctcctcttcgagaacaccatgtccgtcaccaagttcaacgccatggtctccggcctcttc
cagctggggagctcctacgagtgggtcgtcaccaagaaggccggcaggacctcgtcggag
tccgacatcctcgccctcgccgaggccgccgacgccgacgcccggccgccaccggccaag
ctccaccgcggcgtctccgagggcggcctcaaggagtgggccaagctgcacaaggagcag
gaggacgccacggcggcggcggcggcggcggcggcgccggggacgccggtgaagaagagc
aaggcggcgaaggctccgaaccggatcttcaagaaggagctcgcgctggcgttcctcctc
ctcaccgccgccacgcgcagcttgctctcggcgcaggggctgcacttctacttcctcctc
ttccagggcgtcaccttcctcgccgtcggcctcgacctcatcggcgagcaggtCAGCTAG

Protein

480 aa

>Os08t0253800-01 Similar to Cellulose synthase-like family C3 protein (Fragment).
MPMCNEKEVYETSISHVCQIDWPRERMLVQVLDDSDDETCQMLIKAEVTKWSQRGVNIIY
RHRLNRTGYKAGNLKSAMSCDYVRDYEFVAIFDADFQPNPDFLKLTVPHFKGNPELGLVQ
ARWSFVNKDENLLTRLQNINLCFHFEVEQQVNGVYLSFFGFNGTAGVWRIKALEDSGGWM
ERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCELPESYQAYRKQQHRWHSGPMQLFRLCLP
AVFKSKISTWKKANLVMLFFLLRKLILPFYSFTLFCVILPLTMFVPEAELPIWVICYVPV
IMSVLNILPAPKSFPFVIPYLLFENTMSVTKFNAMVSGLFQLGSSYEWVVTKKAGRTSSE
SDILALAEAADADARPPPAKLHRGVSEGGLKEWAKLHKEQEDATAAAAAAAAPGTPVKKS
KAAKAPNRIFKKELALAFLLLTAATRSLLSAQGLHFYFLLFQGVTFLAVGLDLIGEQVS*

5'UTR

chr08:9384129..9384137 (+ strand) : 9 bp

CDS

chr08:9384138..9384161 (+ strand) : 24 bp

chr08:9384408..9384716 (+ strand) : 309 bp

chr08:9385853..9386143 (+ strand) : 291 bp

chr08:9386403..9386516 (+ strand) : 114 bp

chr08:9386623..9387324 (+ strand) : 702 bp

3'UTR

chr08:9387325..9387669 (+ strand) : 345 bp

FASTA

>Os08t0253800-01 class=Sequence position=chr08:9384129..9387669 (+ strand)
ctcatccaga tgccaatgtg caacgagaaa gaggtaaTCA ATTATATTGA caatgtttta aatagcgagc taaggcattt
agcggttagc ttctcaaaca gctatagcga cagctgtagc aggctaaatg gagctatagc ggctaaattg tacataagaa
caaatagcta gaacccttct aaaacagcta tagcgggAGA TTTAAAACCC TATGTACACT ACATATTGAT ATGGAGTTGT
TTCCGAGCAT ATGATTATGA AATTAATGTT GTGTTGCAGG TGTATGAGAC GTCGATATCG CATGTGTGCC AGATCGACTG
GCCGCGGGAG AGGATGCTGG TGCAAGTGCT GGACGACTCG GACGACGAGA CGTGCCAGAT GCTGATCAAG GCGGAGGTGA
CCAAGTGGAG CCAGCGCGGC GTCAACATCA TCTACCGCCA CCGCCTCAAC CGCACCGGTT ACAAGGCCGG CAACCTCAAG
TCCGCCATGA GCTGCGACTA CGTCCGCGAC TACGAGTTCG TCGCCATCTT CGACGCTGAC TTCCAGCCTA ACCCCGACTT
CCTCAAGCTC ACCGTCCCAC ACTTCAAGGT AATATACATA CCCCTTCATT CTAAAGAAAA GTCCAATCCT ATCATTGAAT
CTGGAcgtag ctagagtttg tctttttttt tttagacaga gtagtaaata gtacatgtca cactCTTCAT CTTCTTTAAG
CAATATATAT GTGGAGATTT CGTTGAGCAA CTGAAATCAT CCGATTTCTG CAACAAACCG TACACTGATT GAGTAATATC
GAAACACTCT TCTGCACCCT GTTTATAAAT TGATACTAGC TAGTCTAATA GTATATGTGC CAAATGTGCA TATATATAAG
TATATGTCCA ATGGGATTGA AAGATGTGTG CCTTCAGTTC CAAGTCTCAG ATCTCAATGG CCAGAGGATT GCATTACTAT
AAGTTAGCCA GTGTTGAATC GCGGGTAGAA ATATTCCCTA AGAGCTCGAG ATCAGTATAG TATACAAATG TGTTGAGATT
ATGCTTTGGT ATTAGAGCCT AATAAAAGCC ATGGCGACTT ACAAGGTCTG TAATAAACCT CTGCCTAATT AATTAGTTAG
TGATTATTTA TAATAGTACT ACTACTAACA ACATGTTAAG AGGGGTATAC TATTTGGACT TTGGACATGC AAGTAATAAG
CGTTTCTGCA GTTAGGGCAT GCATGCATGG ACCATGTAAG TCCAAATCAT AGATTCGGTA CAGTAGTTGA CCTCCAAAGA
TTGGCTCTCC TTTTGACTAA ACTGATGCGT GCGTTCACAT TACTATACAT GTTGCACAAC TGCCGAATCT AGCGATACAG
TAGTCTCATC TTTAGAATAA ACTTAACTTC ATGATGCAAA ATATGGGACC CATCAGTCAG TGAGACACAT TATCACAATC
CATTAATATA AAGGGTCTCT TATGTTTCAT TAATTTTATG CATGGATTAT ACATTTTTAG ACCGTTTTAG ATCGGAGATC
TACAAGTCGC GAAAGATGAG GCTAATACAT ATCGAATCCC AAGGTCAATG GAATCATTTT GTGATTTAAT TTGCTTCTTC
TAGAATAACC AATTAATTAA TTAATTAATT AACAAGCGGA TAATTAGGTC AAACATGTTG GAGATCGATC AATCAAACAA
ACTAAACTAA ATCGAAAtga aattttgtgt acgtattaca atagggaaac ccggagctag ggctggtgca ggcgcggtgg
agcttcgtga acaaggacga gaacctgctg acccggctgc agaacataaa cctgtgcttc cacttcgagg tggagcagca
ggtgaatggc gtctacctca gcttcttcgg gttcaacggc accgccggcg tgtggcgcat caaggccctc gaggactccg
gcggctggat ggagcggacc accgtcgagg acatggacat cgccgtccgc gcccacctca acggctggaa gttcatcttc
ctcaacgacg tcaaggtatG TATGTTAACC ATGCATCCAG CCATCCACAT GTCCATGCTC CATGGTTGTT TAATCAGGGT
TTTAAATCTC CGTCTAAAAA GTGTTTTAGC TATTTACTCT CATGTAAAAT TTAATTGCTA TAGCTGTATT tatttagccc
gctatagtta tttgagaagg ccaaccacta aatatcttag cctgctattt aaaacattgg ctatggctaC TATGATTGAA
CGATGCCATT TGTTGCATTC TTGTATTATT CTAGGTCCTC TGTGAGCTGC CGGAGTCGTA CCAGGCTTAC CGGAAGCAGC
AGCACCGGTG GCACTCCGGC CCCATGCAGC TCTTCCGTCT CTGCCTCCCG GCCGTCTTCA AGTCCAAGGT AATAACCTCA
TCGACGCCGG CGCGCCGGCC GCCGCCATTG CTAATGAGAT GAGGATGATC TCGAGCTAAT TCAGCTCTGA CACTATATTA
TATGATATTt gcagatctcg acgtggaaga aggcgaacct ggttatgctg ttcttcctgc tgcggaagct gatcctgcca
ttctactcgt tcacgctctt ctgcgtgatc ctgccgctga ccatgttcgt gccggaggcg gagctgccga tctgggtgat
ctgctacgtg ccggtgatca tgtcggtgct caacatcctg ccggcgccca agtcgttccc cttcgtcatc ccttacctcc
tcttcgagaa caccatgtcc gtcaccaagt tcaacgccat ggtctccggc ctcttccagc tggggagctc ctacgagtgg
gtcgtcacca agaaggccgg caggacctcg tcggagtccg acatcctcgc cctcgccgag gccgccgacg ccgacgcccg
gccgccaccg gccaagctcc accgcggcgt ctccgagggc ggcctcaagg agtgggccaa gctgcacaag gagcaggagg
acgccacggc ggcggcggcg gcggcggcgg cgccggggac gccggtgaag aagagcaagg cggcgaaggc tccgaaccgg
atcttcaaga aggagctcgc gctggcgttc ctcctcctca ccgccgccac gcgcagcttg ctctcggcgc aggggctgca
cttctacttc ctcctcttcc agggcgtcac cttcctcgcc gtcggcctcg acctcatcgg cgagcaggtC AGCTAGCGAC
CACCACCACA ATAAAGAAAA AAAAGCCACC GCCGCCGCCG CTGCCGCCGC CATGCGTGCA CAGCGCGCCG GCTGGCTGGC
CGGAGGCGAA GACGACGACG GCCAGCCAAG ACACTTCCAT GGATCGACAG AGGATTACAT TTTTAGCCTT CTTCTCCTTA
TTTTTATCCC TTTGATATAT TTTTTGTTCA GAGATAAAAA AAACAGAGTG CGTCTCCATG TTACAAAGAA CTCTTCTTTT
CTTTGTGCTT TAATTAGCTA GTGCTTTGTT GCTAGGAGAG GCAAGCAGGC CGCATCAGGT TGTTAATTAC ATTCAGATTA
AGTTGTGTCA ATTCAGTAGC C

Locus: Os08g0253800

Loading...

Locus: Os08g0253800

Loading...