Os08t0258200-01

Locus

Os08g0258200

Description

Ankyrin domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

XBOS35

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK067289 (DDBJ, Best hit)

Protein Evidence

B6U0P6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, RING-type (IPR001841)

Ankyrin repeat (IPR002110)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, RING-type, conserved site (IPR017907)

Zinc finger, C3HC4 RING-type (IPR018957)

Ankyrin repeat-containing domain (IPR020683)

Full-length cDNA

J013103K22 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0258200-01)

RiceXPro (AK067289)

Others

Oryzabase (11149)

KEGG (Os08t0258200-01)

Transcript

1758 bp

>Os08t0258200-01 Ankyrin domain containing protein.
AATATTGTAGTTCCTACTACAGGCTCTCCATTCTCGTTGCCTTGCTAGCTAGCCTTGGCA
TAGGAATCCTTTGATTGTTTTGTAGGTCCAGGGTAGACGCATCATGGGGCTCTTAGGTAT
GGTGGGCGACTCATTCGGTTGCTCAGCTACTGGTGAGCGGCTTGTCTCTGCTGCAAGGGA
TGGAGACATCCAGGAGGCTATGGCCCTGTTGGAGCTTAACCCCCGACTTGCGCGGTATTC
AACGTTTGGGATCCGGAACTCACCCCTTCATTACTCAGCAGCAAAGGGCCACCATGAGAT
TGTTTCTCTCCTAATTGAGTCTGGTGTTGATATCAACCTCAGGAACTGCAGAGGACAGAC
TGCTCTAATGCAAGCTTGTCTATATGGTCATTGGAAAGTTGTACAGATCCTAGTTCTTTT
TAAAGCTAATATTCACAAAAAAGATTGTTTTAGTGGCGCGACAGCTATTCATTTTGCCGC
CCTAAAAGGTCATACTCGGTGCCTTCGGCTCCTTGTGGCTGATTACGTACCAAGCTTGCC
AGAATTTTGGAGTGTAATGCACGCAAAATGCACAGATGAAACAAATAAGGAAGCTTTTGA
TGCGGTAGCTCTCCGGAGGCTAATAAACAACAAGTCTGATGGGGGCGTCACACCGCTTCA
CTTGGCAGCCCTTCATGGGCATGCTGAGTGCGTGCAATTGCTGTTAGACCTTGGAGCCTC
TGTTTCAGAGGTCACTATCAATGATGGTTCAACTATTGATCTCATAGGTTCAGGAAGCAC
ACCTCTCCACTATGCGGCCTGTGGTGGAAGTGCTGTATGCTGTCAACTTCTTGTTGCAGC
CGGAGCAAACATGAGAGCTCAAAATACTAACGGGTTGACCCCTTTGATGGTGGCTCGTTC
ATGGCACAAAAGTAGTGTTGAAGGTATCCTAACCAAACGGTCAGAAGTTCCAGTACGCAT
TCTTCCATCATCATATCTGTCTCTCCCACTGATGAGCATTGTCAAAATTGCCAGGGAATG
TGGGTGGAGAAAAACTTCTGTCTCATCTGTTTGCCATGACCCATGCGCCATATGTTTGGA
TACGGAATGTACAGTGTCTGCAGAAGGGTGTGGCCATGAGTTCTGCACCAAATGTGCGCT
CTACTTGTGCGCCACCGCTAGCAGCTCAACATCTATCCGTGGTGTTCCTGGCTCCATACC
TTGCCCTTTGTGCCGCCACACGATTGTCTCATTCGTTAGACTCACAAGTACAACCCCAAT
AAAGGAGCTTCCGTGGACGAACAAATCGTTAGCTCTATGTGCAGCAGGGGCAAGCACCGG
TTCCAAATATGCTGGTCCTGCAGCAATCACTAGTTCCAAGTATGCCGGTTCTTTGCACCG
AAGGTCTGAGATGCGCAGCCTGCGCTCCTCTTCAGTTGATCTAGGCTGCTCATCGTTTCG
AACCGCGAGCTCAGGGAAGCTGTCGTCGATAAAGCTGAATTGCACCGGAGCCGACGAGAC
GATGCCCTGCCTCGTCAATTGCTTCAGGCCGGATGTGCAGCGGTCGTCTTCGTATAGGGA
AAGAATTAGGAGATATTCACAATTTTCATAGCATTACTGTCTATTTGTATTTGTGCCTCC
CATCCATTTTGTGAGTTTCCGGGGGTTTGGCAGTACAAACTTGTGCAGTGTTTGTTCATG
CTTTTCTCTTGGCTTCTTCATACCTGTAGTCTGTTCTGTTCTTCTGCTTGTGGTCTTGTA
ACATGACATGTGATCCTC

CDS

1488 bp

>Os08t0258200-01 Ankyrin domain containing protein.
ATGGGGCTCTTAGGTATGGTGGGCGACTCATTCGGTTGCTCAGCTACTGGTGAGCGGCTT
GTCTCTGCTGCAAGGGATGGAGACATCCAGGAGGCTATGGCCCTGTTGGAGCTTAACCCC
CGACTTGCGCGGTATTCAACGTTTGGGATCCGGAACTCACCCCTTCATTACTCAGCAGCA
AAGGGCCACCATGAGATTGTTTCTCTCCTAATTGAGTCTGGTGTTGATATCAACCTCAGG
AACTGCAGAGGACAGACTGCTCTAATGCAAGCTTGTCTATATGGTCATTGGAAAGTTGTA
CAGATCCTAGTTCTTTTTAAAGCTAATATTCACAAAAAAGATTGTTTTAGTGGCGCGACA
GCTATTCATTTTGCCGCCCTAAAAGGTCATACTCGGTGCCTTCGGCTCCTTGTGGCTGAT
TACGTACCAAGCTTGCCAGAATTTTGGAGTGTAATGCACGCAAAATGCACAGATGAAACA
AATAAGGAAGCTTTTGATGCGGTAGCTCTCCGGAGGCTAATAAACAACAAGTCTGATGGG
GGCGTCACACCGCTTCACTTGGCAGCCCTTCATGGGCATGCTGAGTGCGTGCAATTGCTG
TTAGACCTTGGAGCCTCTGTTTCAGAGGTCACTATCAATGATGGTTCAACTATTGATCTC
ATAGGTTCAGGAAGCACACCTCTCCACTATGCGGCCTGTGGTGGAAGTGCTGTATGCTGT
CAACTTCTTGTTGCAGCCGGAGCAAACATGAGAGCTCAAAATACTAACGGGTTGACCCCT
TTGATGGTGGCTCGTTCATGGCACAAAAGTAGTGTTGAAGGTATCCTAACCAAACGGTCA
GAAGTTCCAGTACGCATTCTTCCATCATCATATCTGTCTCTCCCACTGATGAGCATTGTC
AAAATTGCCAGGGAATGTGGGTGGAGAAAAACTTCTGTCTCATCTGTTTGCCATGACCCA
TGCGCCATATGTTTGGATACGGAATGTACAGTGTCTGCAGAAGGGTGTGGCCATGAGTTC
TGCACCAAATGTGCGCTCTACTTGTGCGCCACCGCTAGCAGCTCAACATCTATCCGTGGT
GTTCCTGGCTCCATACCTTGCCCTTTGTGCCGCCACACGATTGTCTCATTCGTTAGACTC
ACAAGTACAACCCCAATAAAGGAGCTTCCGTGGACGAACAAATCGTTAGCTCTATGTGCA
GCAGGGGCAAGCACCGGTTCCAAATATGCTGGTCCTGCAGCAATCACTAGTTCCAAGTAT
GCCGGTTCTTTGCACCGAAGGTCTGAGATGCGCAGCCTGCGCTCCTCTTCAGTTGATCTA
GGCTGCTCATCGTTTCGAACCGCGAGCTCAGGGAAGCTGTCGTCGATAAAGCTGAATTGC
ACCGGAGCCGACGAGACGATGCCCTGCCTCGTCAATTGCTTCAGGCCGGATGTGCAGCGG
TCGTCTTCGTATAGGGAAAGAATTAGGAGATATTCACAATTTTCATAG

Protein

496 aa

>Os08t0258200-01 Ankyrin domain containing protein.
MGLLGMVGDSFGCSATGERLVSAARDGDIQEAMALLELNPRLARYSTFGIRNSPLHYSAA
KGHHEIVSLLIESGVDINLRNCRGQTALMQACLYGHWKVVQILVLFKANIHKKDCFSGAT
AIHFAALKGHTRCLRLLVADYVPSLPEFWSVMHAKCTDETNKEAFDAVALRRLINNKSDG
GVTPLHLAALHGHAECVQLLLDLGASVSEVTINDGSTIDLIGSGSTPLHYAACGGSAVCC
QLLVAAGANMRAQNTNGLTPLMVARSWHKSSVEGILTKRSEVPVRILPSSYLSLPLMSIV
KIARECGWRKTSVSSVCHDPCAICLDTECTVSAEGCGHEFCTKCALYLCATASSSTSIRG
VPGSIPCPLCRHTIVSFVRLTSTTPIKELPWTNKSLALCAAGASTGSKYAGPAAITSSKY
AGSLHRRSEMRSLRSSSVDLGCSSFRTASSGKLSSIKLNCTGADETMPCLVNCFRPDVQR
SSSYRERIRRYSQFS*

5'UTR

chr08:9632619..9632710 (- strand) : 92 bp

chr08:9632535..9632545 (- strand) : 11 bp

CDS

chr08:9632340..9632534 (- strand) : 195 bp

chr08:9632163..9632222 (- strand) : 60 bp

chr08:9631627..9631698 (- strand) : 72 bp

chr08:9631364..9631539 (- strand) : 176 bp

chr08:9631123..9631283 (- strand) : 161 bp

chr08:9630924..9630982 (- strand) : 59 bp

chr08:9630803..9630849 (- strand) : 47 bp

chr08:9630205..9630345 (- strand) : 141 bp

chr08:9629354..9629445 (- strand) : 92 bp

chr08:9628787..9629271 (- strand) : 485 bp

3'UTR

chr08:9628620..9628786 (- strand) : 167 bp

FASTA

>Os08t0258200-01 class=Sequence position=chr08:9628620..9632710 (- strand)
AATATTGTAG TTCCTACTAC AGGCTCTCCA TTCTCGTTGC CTTGCTAGCT AGCCTTGGCA TAGGAATCCT TTGATTGTTT
TGTAGGTCCA GGGTGTGTTG AAAGAGTTAA ATCAAGATTT CGCCGAATCT TTGCAAGGTA ATACTAATTT TTTGTGCTTT
GATAGGTAGA CGCATCATGG GGCTCTTAGG TATGGTGGGC GACTCATTCG GTTGCTCAGC TACTGGTGAG CGGCTTGTCT
CTGCTGCAAG GGATGGAGAC ATCCAGGAGG CTATGGCCCT GTTGGAGCTT AACCCCCGAC TTGCGCGGTA TTCAACGTTT
GGGATCCGGA ACTCACCCCT TCATTACTCA GCAGCAAAGG GCCACCATGA GGTGTTCTAA ATTGATTTTC TCCATATAAT
AGTTTCCTTA TCTATATGCG GTTCTTTTGA GATATCTTTG TTAATTTGTT CAGTCAAGTA ACAATTAATT ATTTCATTAC
TCCATTAGAT TGTTTCTCTC CTAATTGAGT CTGGTGTTGA TATCAACCTC AGGAACTGCA GAGGACAGGT AAAGTTATTT
TCTTTCTCAC CTTGTTCATG GCCATTATTC ATGACCATTA ATATCTTGCC TTGGTTTATA ATATTTCATC AACGTAGCAA
CAAGTGTAAA GAATATTTTC CACTAGGGAC TAAGAAATAC AATCTATTCT TCTAGATTTG GTTTATATGC AAATACTATT
GAAATGTTTT TTTTTGCATA TTATACAAAC ATGTGCATTC CACGTGCATA TGAGGCTCCT AACGTTCTAT GGGATGAGAA
GCAGTAGCCT TTGTTAGAAA GGGGCAGCAA GCTAGACAGA CCTACTTTTC TTTTGTTTGG ATTATGTTGT TTACCTTAGC
TTTGATATAA CACATGGAGT ACTCTTCAAT GGATAATTGA ATATCAACTC TTTAATTTGT TTTCATTTCT GTTGTGCTAA
ATAAAATGTT TCTATGGTTT TGTGCTAATG AACAATAAAC TGCCGTACGC AGACTGCTCT AATGCAAGCT TGTCTATATG
GTCATTGGAA AGTTGTACAG ATCCTAGTTC TTTTTAAAGC TAATGTAAGT TACCTTTAGC TAACTTGTTC TTGTGTCAAA
TCACACTGCA ATATCGACTG ATGCAAGTTA TCTATATCTT TCATTTTCTA GATTCACAAA AAAGATTGTT TTAGTGGCGC
GACAGCTATT CATTTTGCCG CCCTAAAAGG TCATACTCGG TGCCTTCGGC TCCTTGTGGC TGATTACGTA CCAAGCTTGC
CAGAATTTTG GAGTGTAATG CACGCAAAAT GCACAGATGA AACAAATAAG GAAGCTTTTG ATGCGGTGTA TGTTAAATTC
TGACGTTAGT CTATGTTGGC ATCTACTGAT GACTAATAAT TGCACCCCTT TACATTCTGA TTTCCAGAGC TCTCCGGAGG
CTAATAAACA ACAAGTCTGA TGGGGGCGTC ACACCGCTTC ACTTGGCAGC CCTTCATGGG CATGCTGAGT GCGTGCAATT
GCTGTTAGAC CTTGGAGCCT CTGTTTCAGA GGTCACTATC AATGATGGTT CAACTATTGA TCTCATAGGT ATGAAGCTAA
ATGTTTTTAA CTCAATTCAA CTCCTAATGG AACTTGACCA TTGGTTCTGA CAAGAAAATA TAGTGCACAA GTGGAACCGT
ATCCAGGTTT TTATATGCTC ATAGATTAGC TCTTCTTCCA TTTTGCAGGT TCAGGAAGCA CACCTCTCCA CTATGCGGCC
TGTGGTGGAA GTGCTGTATG CTGTCAAGTA TGCATCAATT TTCTCTTTCA TGCGATTCCA AACAATTGGG CAATGTCCAT
TTACTGATTG CTGTTAAACA GCTTCTTGTT GCAGCCGGAG CAAACATGAG AGCTCAAAAT ACTAACGGGT ATGCAATAGC
AAGTCCATCA TAAAAGATTT ATTAGTTCTA CATAGCATAT ATCGAACATA TCTAATTGGG GATGTTTACC TTACAATTAC
CACATTCAAG TGTCACATAT TTCTGAGATG CTTTCTGCAA ATTTGATCTC TTAACTGAGG TCGACTTGTC AAAACTTCAT
GCTGCTAGTA TGTGGCTGGA ACTCTGGACA GGAATTTCCA AGCTAATTAT GCTAAATAAT AACATGGTTT GAACAATGAT
TTCTAAGTAA CCCATATTTA TTTTGAGTTT CAACTCAAAT TCTGCAACTA TGGTTCTGTG TGGACTTAAA TACAACATGA
ATTATTTCCT GTTCCTAATC AATGAAGGCA GGTTGCATGT GGACTGTTTA TCCTTCATTA TCTATAGAAA ATTCACTATA
ATTTATTTGG ATTGCTTACT CTTCTGCAAT GCTATTTGCT TGAAGGTTGA CCCCTTTGAT GGTGGCTCGT TCATGGCACA
AAAGTAGTGT TGAAGGTATC CTAACCAAAC GGTCAGAAGT TCCAGTACGC ATTCTTCCAT CATCATATCT GTCTCTCCCA
CTGATGAGCA TTGTCAAAAT TGCCAGGTGA GTAAAACAAG TGATGTCATA GGTAGATCCT ATTATCATTT TGTTTGTCTG
AAATTACCAG ACCAGTACCT ATCTGTTTCC ATAATAGAAA TGAAACATGT CCAAAGTTGA CCAAACATCT GTACTCAAGT
AGTTTTTTCA ACAGAGCACA AACCTCTGTT CCACCAGAAG AGGTAAGATT CACCAATGTT TCACGGTAGG CAATTGCCTA
TAGGCTTCAG GAGGTCAGGA GATAAAACAG TTCATTGCAG TAGAAACCAA ACTTCACTAG GGGAGAAATA TTGGGAAAGA
GAACAAGAAT CTCAGTATCC AGAAACCTTT TTCTTAGGCC CATTTACAAT TTTTAATGTT CACACAGGAT TAAAAAATGG
TACTTCAATT TTCCCCATCT CTGCCACTCG CGTTAGCAGG GAATGAAATT CCATCTGGGA CATTTTCTGC TGGGGCTAGG
CTGGGAGCCA ACACACCAGG ATTACCCCAG CTCCTGGTGG AAATTGATTT GCCAGTTATT CCCTTACGGA CTTTTGATTA
AACTCGAACT TCCAACAATA GTACTGTAGC CAAAACAATA GTACTGTAAC AGCAATGAGA GTTCAATGGC GCAAGGGCAA
GGAACAAGCC AAAACATCCA TTGACCAGGT GTTCTGTAGG TCTGTAGCAC CACACACACA CACTAGGAAC TGTCTAGTTA
CTAGTAAGAT TTAGAACCTT GAGCATTAAT TTACATATAT TCAATCGTTT GTGGATCTTT TACAGGGAAT GTGGGTGGAG
AAAAACTTCT GTCTCATCTG TTTGCCATGA CCCATGCGCC ATATGTTTGG ATACGGAATG TACAGTGTCT GCAGAAGGTA
TTCTTGAACT ACCCCACAGT AGAATACTTC TATTCCACTA ATCCCGTTTA AATTCATATG ATTTTATTTT CTTTTATAGG
GTGTGGCCAT GAGTTCTGCA CCAAATGTGC GCTCTACTTG TGCGCCACCG CTAGCAGCTC AACATCTATC CGTGGTGTTC
CTGGCTCCAT ACCTTGCCCT TTGTGCCGCC ACACGATTGT CTCATTCGTT AGACTCACAA GTACAACCCC AATAAAGGAG
CTTCCGTGGA CGAACAAATC GTTAGCTCTA TGTGCAGCAG GGGCAAGCAC CGGTTCCAAA TATGCTGGTC CTGCAGCAAT
CACTAGTTCC AAGTATGCCG GTTCTTTGCA CCGAAGGTCT GAGATGCGCA GCCTGCGCTC CTCTTCAGTT GATCTAGGCT
GCTCATCGTT TCGAACCGCG AGCTCAGGGA AGCTGTCGTC GATAAAGCTG AATTGCACCG GAGCCGACGA GACGATGCCC
TGCCTCGTCA ATTGCTTCAG GCCGGATGTG CAGCGGTCGT CTTCGTATAG GGAAAGAATT AGGAGATATT CACAATTTTC
ATAGCATTAC TGTCTATTTG TATTTGTGCC TCCCATCCAT TTTGTGAGTT TCCGGGGGTT TGGCAGTACA AACTTGTGCA
GTGTTTGTTC ATGCTTTTCT CTTGGCTTCT TCATACCTGT AGTCTGTTCT GTTCTTCTGC TTGTGGTCTT GTAACATGAC
ATGTGATCCT C

Locus: Os08g0258200

Loading...

Locus: Os08g0258200

Loading...