Os08t0270400-00

Locus

Os08g0270400

Description

Similar to Cinnamyl alcohol dehydrogenase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CAD5

CGSNL Gene Name

CINNAMYL ALCOHOL DEHYDROGENASE 5

Oryzabase Gene Symbol Synonym(s)

OsCAD5

Oryzabase Gene Name Synonym(s)

Cinnamyl alcohol dehydrogenase 5

Transcript Evidence

AK332010 (DDBJ)

Protein Evidence

Q8S411 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

Alcohol dehydrogenase superfamily, zinc-type (IPR002085)

Alcohol dehydrogenase, zinc-type, conserved site (IPR002328)

GroES-like (IPR011032)

Alcohol dehydrogenase, C-terminal (IPR013149)

Alcohol dehydrogenase GroES-like (IPR013154)

NAD(P)-binding domain (IPR016040)

Polyketide synthase, enoylreductase (IPR020843)

Expression Databases

TENOR (Os08t0270400-00)

Others

Oryzabase (10434)

Transcript

1061 bp

>Os08t0270400-00 Similar to Cinnamyl alcohol dehydrogenase.
TCGATGGCTCCCACGGCGGCGGCGGGGCTGGCAGCGCGCGACGCGTCCGGCCACCTCTCC
CCGCTCACCATCTCCCGCAGGAGCACTGGAGATGATGATGTGGTGATAAAGATTCTTTAC
TGTGGGATCTGCCACTCCGACCTGCACAGCATCAAGAACGAGTGGAAGAACGCCACCTAC
CCACTTGTTCCTGGGCACGAGATCGCCGGCGTGGTGACGGAGGCCGGCAAGAACGTGACC
AAGTTCAAGGGCGGCGACAAGGTGGGCGTCGGGTGCATGGTGAACTCGTGCCACTCCTGC
GACAGCTGCAACCAGGGGTTGGAGAACCACTGCCCAGGCGTGATCTTCACCTACAACTCC
GTCGACAAGGACGGCACCGTCACCTACGGCGGCTACTCGAGCATGGTGGTGGTGCACGAG
CGCTTCGTGGTCAGGTTCCCGGAGGCCATGCCGCTGGACAAGGGCGCGCCGCTGCTCTGC
GCCGGCATCACCGTGTACAGCCCCATGAAGTACCACGGCCTGAACGTCCCCAGCAAGCAC
GTCGGCGTGCTTGGCCTCGGCGGGCTCGGCCACGTCGCGGTGAAGTTCGCCAAGGCGTTC
GGGATGACGGTGACGGTGATCAGCTCGTCGCCGGGGAAGAGGCAGGAGGCGCTGGAGCGG
CTCGGCGCCGACGCGTTCGTCGTCTCCAAGAATGCCGACGAGATGAATGCCGCGACGGGC
ACCATGGACGGCATCATCAACACGGTGTCTGCCAACATTCCGATCGCGCCGCTGCTGGGT
CTGCTGAAGCCCAACGGGAAGATGATCCTCCTGCTCTGTGTTGTGATCCATTACATTCTG
TCTGTGGCATGCATGTTGCAGCGAACAAGACGCTGGCCGGGAGCTGCATCGGCGGCATGG
CGGACACGTAGGAGATGATCGACCTGGCAGCGAAGCACGGCGTGACGGCGGAGATCGAGG
TGATCGGCGCCGACTACGTGAACACGGCCATGGAGCGCCTCGCCAAGGCCGACGTCAGGT
ACCGCTTCGTCATCGACATCGGCAACACCCTCAAGGACGCC

CDS

915 bp

>Os08t0270400-00 Similar to Cinnamyl alcohol dehydrogenase.
ATGGCTCCCACGGCGGCGGCGGGGCTGGCAGCGCGCGACGCGTCCGGCCACCTCTCCCCG
CTCACCATCTCCCGCAGGAGCACTGGAGATGATGATGTGGTGATAAAGATTCTTTACTGT
GGGATCTGCCACTCCGACCTGCACAGCATCAAGAACGAGTGGAAGAACGCCACCTACCCA
CTTGTTCCTGGGCACGAGATCGCCGGCGTGGTGACGGAGGCCGGCAAGAACGTGACCAAG
TTCAAGGGCGGCGACAAGGTGGGCGTCGGGTGCATGGTGAACTCGTGCCACTCCTGCGAC
AGCTGCAACCAGGGGTTGGAGAACCACTGCCCAGGCGTGATCTTCACCTACAACTCCGTC
GACAAGGACGGCACCGTCACCTACGGCGGCTACTCGAGCATGGTGGTGGTGCACGAGCGC
TTCGTGGTCAGGTTCCCGGAGGCCATGCCGCTGGACAAGGGCGCGCCGCTGCTCTGCGCC
GGCATCACCGTGTACAGCCCCATGAAGTACCACGGCCTGAACGTCCCCAGCAAGCACGTC
GGCGTGCTTGGCCTCGGCGGGCTCGGCCACGTCGCGGTGAAGTTCGCCAAGGCGTTCGGG
ATGACGGTGACGGTGATCAGCTCGTCGCCGGGGAAGAGGCAGGAGGCGCTGGAGCGGCTC
GGCGCCGACGCGTTCGTCGTCTCCAAGAATGCCGACGAGATGAATGCCGCGACGGGCACC
ATGGACGGCATCATCAACACGGTGTCTGCCAACATTCCGATCGCGCCGCTGCTGGGTCTG
CTGAAGCCCAACGGGAAGATGATCCTCCTGCTCTGTGTTGTGATCCATTACATTCTGTCT
GTGGCATGCATGTTGCAGCGAACAAGACGCTGGCCGGGAGCTGCATCGGCGGCATGGCGG
ACACGTAGGAGATGA

Protein

305 aa

>Os08t0270400-00 Similar to Cinnamyl alcohol dehydrogenase.
MAPTAAAGLAARDASGHLSPLTISRRSTGDDDVVIKILYCGICHSDLHSIKNEWKNATYP
LVPGHEIAGVVTEAGKNVTKFKGGDKVGVGCMVNSCHSCDSCNQGLENHCPGVIFTYNSV
DKDGTVTYGGYSSMVVVHERFVVRFPEAMPLDKGAPLLCAGITVYSPMKYHGLNVPSKHV
GVLGLGGLGHVAVKFAKAFGMTVTVISSSPGKRQEALERLGADAFVVSKNADEMNAATGT
MDGIINTVSANIPIAPLLGLLKPNGKMILLLCVVIHYILSVACMLQRTRRWPGAASAAWR
TRRR*

5'UTR

chr08:10358376..10358378 (- strand) : 3 bp

CDS

chr08:10358299..10358375 (- strand) : 77 bp

chr08:10356821..10356934 (- strand) : 114 bp

chr08:10355768..10356383 (- strand) : 616 bp

chr08:10355556..10355663 (- strand) : 108 bp

3'UTR

chr08:10355413..10355555 (- strand) : 143 bp

FASTA

>Os08t0270400-00 class=Sequence position=chr08:10355413..10358378 (- strand)
TCGATGGCTC CCACGGCGGC GGCGGGGCTG GCAGCGCGCG ACGCGTCCGG CCACCTCTCC CCGCTCACCA TCTCCCGCAG
GTGAAACTTC AATTATACTC CTATATATAT CTAGATAGGG TTCTCTAGAT AGTAGTGTAA TGTTGCGAGG GGCTAGCTAG
CGCTGTTCCG TTCGTACACG TGATGCCGTT CGTGAGCGGC GCCGGCGCCG GACCGAGTAG GGAATACCGT TCGTGAGCAC
GGCAGCGGCG GCGGCGTTGG CGTGCGTGGA GATGGATGAT TCTGTTGAAA CCTCTATTCC CATCGATATT CATGATAGTT
CATGATTCTG TTCAGGCTTG TTTCGTTCGA TTTTGCCGAC ATGTCGTAGT ACATGGTACT ACCTCCATCT AGATTTGGGC
ACAtagaatt aaatggtgga aggttattat tgattaagaa gtgcaggtac atggggaaat taaatggtga agggttataa
ttggttgata aaggattgtt ggtggagaaa ttgtattttg ggataaattt taaaggctat gttatatttt gcgacggaAA
CAAAAATATC CAATCCAGGT TCTGACCTTG GGATTAATTT CTTGGCATCA CACAAATTAA TTTATAGGAA ATAAACTTAT
TTCAGCAACA ACTTAATTAT ATTTTAGTAC TGTTTGTCCT AGAAAATAAT CAGAATAATA TATGATATAG ATAGATAGAT
ACTAGTAGAT AGGTAGGTAG GTAGTCGTAC TGCTGTTTAG GGTGCATGCA TAGTAGGATG ATACTATCAC GTACGTCCCT
TCATGCGACG GTTTAATTTG TCGATCTAGT GGCAGTCCAA CCTATTACAC ACCAAAATCG ATCAACATGT GGTTTTGCAC
TGTTCTTTTG TGAGGTACAT GCACCGGGAG GCTTATGTTG ACACATAATC CAAACCGCAT TGTTTGTGAT TACGTGATCA
GATCGATCAC CTCGTAGTCT TGGTCTCTTG GATCTGTCAT TTTCTGTAGT ACGTACTGTT TGGACTTTTA GAGGTACGAT
GTGTTGAGTA CAACTGTATA TGCACAGTAA TTGGCCATTG TCTCTCTGTT CATATCTAGT GCACTGGTAG CGTTGCACCT
AGGACTTTAC CGTGTGATGG GTTGTATTTC TTCGACTATT GTCACAATCT GTATAATTCC TAGCCATATA CGATTTGCCT
TTTATGCCAG AGTTTAGATT GAGTACGTTT TTAGGCCTCG TTTTAAAGAT GATAATAATT TGAGAGCATA AATAATAATA
TTGATATTGA AAAGCTGAAA AATGATTTAA GAACATACAA AGAAAATAAT GATGAACAAA GTTTTACAAA AGACGCGCCG
TCTAGTAGTT GGTGCCTGTG CGTAGAGTTT TTCTTTAATC AACAATATAA ATAGCGTTTG TGCTAATTAC TTGAAAATCT
GTAGGAGCAC TGGAGATGAT GATGTGGTGA TAAAGATTCT TTACTGTGGG ATCTGCCACT CCGACCTGCA CAGCATCAAG
AACGAGTGGA AGAACGCCAC CTACCCACTT GTTCCTGGGT AATTATTAAT TAAGCAAGCT AGCTTTACAA ACAGGTTTTG
TACGTTGTTA CAtactccct ctattccaaa ttgatctaca tattttatag gtacacaaaa accaagaaaa attaataact
ctctcatact atatttactc taacaacaaa ctcgatgcat gtaccatcac cactattttc taactaatag caaattaaga
tattgcatgt gtgttataaa tacttgtgtg catccatgtg catggatgca cgcatcaatg cccatttact ccaatgcata
aataacgaat agacttaatg aataaataca aatatgcaga taatttagga ataaccttaa aaaaaaacta tatgtagatc
aatttggaat ggagggagta CGATGCATTA TTCTGAATTA ATTCTGATCA AACAAACATG CACTCGATGG CGCAGGCACG
AGATCGCCGG CGTGGTGACG GAGGCCGGCA AGAACGTGAC CAAGTTCAAG GGCGGCGACA AGGTGGGCGT CGGGTGCATG
GTGAACTCGT GCCACTCCTG CGACAGCTGC AACCAGGGGT TGGAGAACCA CTGCCCAGGC GTGATCTTCA CCTACAACTC
CGTCGACAAG GACGGCACCG TCACCTACGG CGGCTACTCG AGCATGGTGG TGGTGCACGA GCGCTTCGTG GTCAGGTTCC
CGGAGGCCAT GCCGCTGGAC AAGGGCGCGC CGCTGCTCTG CGCCGGCATC ACCGTGTACA GCCCCATGAA GTACCACGGC
CTGAACGTCC CCAGCAAGCA CGTCGGCGTG CTTGGCCTCG GCGGGCTCGG CCACGTCGCG GTGAAGTTCG CCAAGGCGTT
CGGGATGACG GTGACGGTGA TCAGCTCGTC GCCGGGGAAG AGGCAGGAGG CGCTGGAGCG GCTCGGCGCC GACGCGTTCG
TCGTCTCCAA GAATGCCGAC GAGATGAATG CCGCGACGGG CACCATGGAC GGCATCATCA ACACGGTGTC TGCCAACATT
CCGATCGCGC CGCTGCTGGG TCTGCTGAAG CCCAACGGGA AGATGATCCT CGTCGGCCTG CCGGAGAAGC CCATGGAGAT
CCCTCCCTTC GCTCTGGTTG CTTGTAAGTG CTTAATTTGA TCCGGATCCA TTACAGCTAG CTACTAGCTA GCTAGCTGCT
CTGTGTTGTG ATCCATTACA TTCTGTCTGT GGCATGCATG TTGCAGCGAA CAAGACGCTG GCCGGGAGCT GCATCGGCGG
CATGGCGGAC ACGTAGGAGA TGATCGACCT GGCAGCGAAG CACGGCGTGA CGGCGGAGAT CGAGGTGATC GGCGCCGACT
ACGTGAACAC GGCCATGGAG CGCCTCGCCA AGGCCGACGT CAGGTACCGC TTCGTCATCG ACATCGGCAA CACCCTCAAG
GACGCC

Locus: Os08g0270400

Loading...

Locus: Os08g0270400

Loading...