Os08t0274700-02

Locus

Os08g0274700

Description

Similar to TTN10.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PSF3

CGSNL Gene Name

PARTNER OF SLD FIVE 3

Oryzabase Gene Symbol Synonym(s)

PSF3

Oryzabase Gene Name Synonym(s)

partner of Sld five 3

Transcript Evidence

AK059326 (DDBJ, Best hit)

Protein Evidence

NP_001147271.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

GINS complex, subunit Psf3 (IPR010492)

GINS complex (IPR021151)

Full-length cDNA

001-026-A02 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0274700-02)

RiceXPro (AK059326)

Others

Oryzabase (7454)

KEGG (Os08t0274700-02)

Transcript

656 bp

>Os08t0274700-02 Similar to TTN10.
AGCCTATTTCGGTAGTTTTTCAAGTGAGTGCAAATGGTGTTGGACTACTAGATCCTGGCG
CTGAAAGAAACAGTGTTGAAAAGGGTGCTAAGGTGGACCTTCCATTTTGGCTTGCACATG
GGCTGCTGTCTCTGGAACAAGCAGTTTCAATAAATGTACCTCCTTGCTTCACCCAGAAAA
CCCGGAAGGAGATCCAAGCTGATGCAGCCTGTGTTGATTTGAGGATTCGTTGCCCTTACT
TCTATGAGCTAGGATGCAAGATAGTCCCTTTGGTGAACGACAGGAGCATTGGACTGTTCT
TGCGCTATGCATTCACTAGTAGGTACAAGGAGATACTAAGCAAGTCACACAGCTCTTCCA
TGATGACAGTGCCCAAGTTTGTTCCGCGCCTTACAAAAGAAGAAGCTCAAGTGTTCGAAT
CTGCTAGGGACTCGATGACCGCTTTCAAGAAGTGGCGCGCTGGCGGTGTGAGGCTGCAGA
AAGCGTCCATTCTTGGTAGGAAAAGGAAGACAAAACTGCCTGATGGACCTTCTGCACCTT
GAACCATGTTTTAGGTTCTTCTGTATGGAAAATCGTACTTGAGCTGATGTATGTATACTT
CATTAATATGTCGCTGTAAGAGAAGACCAAAAGTGAAACAATTCCGTTCGGAGATC

CDS

540 bp

>Os08t0274700-02 Similar to TTN10.
CCTATTTCGGTAGTTTTTCAAGTGAGTGCAAATGGTGTTGGACTACTAGATCCTGGCGCT
GAAAGAAACAGTGTTGAAAAGGGTGCTAAGGTGGACCTTCCATTTTGGCTTGCACATGGG
CTGCTGTCTCTGGAACAAGCAGTTTCAATAAATGTACCTCCTTGCTTCACCCAGAAAACC
CGGAAGGAGATCCAAGCTGATGCAGCCTGTGTTGATTTGAGGATTCGTTGCCCTTACTTC
TATGAGCTAGGATGCAAGATAGTCCCTTTGGTGAACGACAGGAGCATTGGACTGTTCTTG
CGCTATGCATTCACTAGTAGGTACAAGGAGATACTAAGCAAGTCACACAGCTCTTCCATG
ATGACAGTGCCCAAGTTTGTTCCGCGCCTTACAAAAGAAGAAGCTCAAGTGTTCGAATCT
GCTAGGGACTCGATGACCGCTTTCAAGAAGTGGCGCGCTGGCGGTGTGAGGCTGCAGAAA
GCGTCCATTCTTGGTAGGAAAAGGAAGACAAAACTGCCTGATGGACCTTCTGCACCTTGA

Protein

180 aa

>Os08t0274700-02 Similar to TTN10.
PISVVFQVSANGVGLLDPGAERNSVEKGAKVDLPFWLAHGLLSLEQAVSINVPPCFTQKT
RKEIQADAACVDLRIRCPYFYELGCKIVPLVNDRSIGLFLRYAFTSRYKEILSKSHSSSM
MTVPKFVPRLTKEEAQVFESARDSMTAFKKWRAGGVRLQKASILGRKRKTKLPDGPSAP*

5'UTR

chr08:10572096..10572097 (+ strand) : 2 bp

CDS

chr08:10572098..10572169 (+ strand) : 72 bp

chr08:10572529..10572632 (+ strand) : 104 bp

chr08:10572825..10572917 (+ strand) : 93 bp

chr08:10577387..10577526 (+ strand) : 140 bp

chr08:10577640..10577770 (+ strand) : 131 bp

3'UTR

chr08:10577771..10577884 (+ strand) : 114 bp

FASTA

>Os08t0274700-02 class=Sequence position=chr08:10572096..10577884 (+ strand)
AGCCTATTTC GGTAGTTTTT CAAGTGAGTG CAAATGGTGT TGGACTACTA GATCCTGGCG CTGAAAGAAA CAGTGTAAGT
GACTTTTGCA CCTATGGTTT AGTGCTATGG TGTAACTTCC TAGGGCACCT ACTGACCTTT CTTCCTCCAT CCCTATTGTT
CTAGAAGGAA GTTGGTTTGG AATCTATGCA GTAGTTAATT GAGTTTATCT GAGATGAGTG TTATATGACC ATTGGATTTT
ATTTATTAAA ACTGCTTTGG AATGCTAGGT GTACTCTTGT TGGCTTGTAT GACACATTTT CTAGTAAACA CAATCTGGTG
GTGGATGCTT TTTTAGTTTG TCTTGTAAAC ACCTTCACAT CATTTCTTGC TTTGGTTGGA AACAAAAGTG AGAGATTTGC
TCCAGTTAAA CATTGTATCT TCTTTATCTC CAGGTTGAAA AGGGTGCTAA GGTGGACCTT CCATTTTGGC TTGCACATGG
GCTGCTGTCT CTGGAACAAG CAGTTTCAAT AAATGTACCT CCTTGCTTCA CCCAGAAGTA GGTTTCATCA TAACTTGTTT
TTCATTGTTG TATACAGAGA ATCTTAGCTA GAATTCATGT TTCAACAGAT TTACATGAAA GTACTTCTTG TCAACTTACT
GTAGAGGTCT TCTTCAGTAA TTGCAAATGC CTGGTAGTTT CAATATTTCC TAGAAAAGTT GTCCTAAGAT CATAACAACA
TTGCTACAGA ACCCGGAAGG AGATCCAAGC TGATGCAGCC TGTGTTGATT TGAGGATTCG TTGCCCTTAC TTCTATGAGC
TAGGATGCAA GATAGTCCCT TTGTAAGTTC TGAAACGATT TCAATCTCAT GCACTTTTAG GATATAGTTC TGGCTTACTA
CCTGCATCCG CTTTTTACTT GATGCCCTAG AATCTGTGCT GTCAACAATT CTAAAGTTTG ACCACCGGTA AAAGAAAGCA
GAGATATTAT TTACctttgt gttaaaaatc ttactgaatt attagttcat attaaaatgt ttctatgtga tatttgatag
aatagccact tcattgcttt acaaaatTTT GTCCACAAAT GACCTTATTA ACATACGCTA TAATACTTTT CTTTTACAAT
GACTAAGTAA TTCTTTCGGC GTACAACATA CATTTTTCTT TGTGCATGTT TGTTTCAATA TTATAAATGC TTTTGAGTCC
ATTGAAGATA GATTCTTTCA TACTTTCATA AGACAAGTTC ATTTTAAACC CTTGAACTTT GCAAAATTTC TACTTAACTC
CAACAAAAAA AATAGATATG TTTATCTGAT TATCTCCAGA CTTCAAACAA TAGAGCAAGG GTGGTTTTGG AGGTTGTTTT
GCCATTATGG ACACCAACTT CCATGCCATA ACATCTTGGA AATACCACAT TGGTAATTAT CACTTCAAAT AAGATCGAAA
ATACACCAAC ACTCACTTTA TTTCAGTAAT GTCTCTCCTT TTAATCAACC TATCTATCTT TTTGCTCCCC TCTCTTTTAT
CCAAACAAAT TGCTTGGTTT CACAGAAAAC AATCATAAGC AATAGTGAGT TGCTCCTCTC CATATTATGG CTGCAGCCTT
GCTGATGTCA GGCAGCGGTT GTGAAAGTGC TGCTTGATGA ACATGACGTT GCTCAAAACA TAGCTACTGT GTGTTAATAA
TAAAATATAT CTCTGATTCC AAGTTGGATT TGATATTGGT AGATCATCCG AAATTAAAGA AACCACCTTC AATTGAAACT
CTAGTGAGAA GTATAAACAA AAAATGTGGA GGCAGTGGTA AGAGAAGAGG TTGGTCGGCC ATGCCTTGCC ACTTCTTGGT
ATCTAGTCTT GCTGTTCTTG TTTTGCACAA TTGTTATTTT CCATCTAGTG ATTTCAGGTT GTTTAACCTA ATCTTCAGCT
TCAGTATGTT AACAAACCAT TATGTACAGA TGATCATGAA TCATATAAAT TGCTGTGTTT GCTACAGATA ATATTGTATC
ATACATGTTC GATATAAATG AATGTGTCTG TTTTATTAAC ACACCCTTCG TATTTTGTTA AAGCAAACAC TTGATACATT
TCCACAGTTC TATTTGTAAA ATTAGCATAT ATATATATAT ATATATATAT ATAAGCTCTA TTATACACCC CTCCCTTAGA
ATAACTATTC TACACCCCCT CCCACCTCCC ATCCGTCCCC ACCTCCTCCC CTCCCATCGC TCCTCTCTCC CTCCCGCGCC
CCCTTCCTTC CCGCACTCCT CTCCCCCAGT GCCCCCTCTC CCTCCCGCGC CCCCTCTCCC TCCCGTCGTG CCCCTCTCCC
TCCCATCGCT TCTCCCTCCG ATTCCCCctc cttttttttt tctctccctc ctctcttttt tagaaaaatt aaaaataaat
tggtgaattc aagacttgaa cccatgatct catggttcat gacaagcagt tctaaccaaa tcatcgtatg atgatttgtg
aacaAATCAG TTATGTACCT ATAACAATCA TACCTTGTTA CTATGATTCG GCAGTAACAT TATCCCAGAA GCTGCAAAAA
TGTATAGGTT GTTACTGCAC TTTTGGCAGT AACAATATGA CGAAATTTGC AGTAACAGAG AACATGCATA GTAACAGTGG
CCCTATAGTA GTAATTTTTT TAGATCTAGA GTATTTTAAA TCTCAATATT TAGAGAGTAC TAACGTACAC GTCATGTCTT
ATTTTTCTAA CCCATTTGCA TCATGGCGTT CGTAAAAAAA AAGTGCTTAA CCAAACTAGA ACCATCATAA CTATTTTTTA
ACGTTGTTAC TGCGAAAAGC AGTGGTGTTA CTACATATTG GCCATCGTGT TACTACGCTG TTCCAGTGAG ACAAGGACTA
AAAAAGAGGT AAATCTCAAT CTTTAGAGAG CAATATCTCT CACATCATAT CTTGTATTTC CAATCCGTTT GCACCATGAA
GTTCATAAAA AAACGCTTAA CGAAACAAGA TCCATCATGG CTACTTTTTG ACGTTGTTAC TGCGATAATG TGATCTTGTT
ACTGCACGAT GACCGTCCTG TTACTGCACG ATTCCTGCAA GACGAGAGCA GCAAAGTGGT GGGCGGGTTT GACCGGCGGG
AGGACGCTTT GACCGAGGTG GGAGGGGGGT TTTGGGCCAT AGGGAGGGTG GGGGAGGTGG GTTTGGCCCA TGGGAGGGGG
GGTGTAGAAT AGATTCACTA TATGTATATA TAATAAATAA ATAAATAATC TTTTGTGCTA AATTTGTATT TAGAAGGTCG
AACAAGAAAA GCTAACAATA TGTGGAAGTA CTGTCGAAGG GCAATTTGTA AAGCTGATGT AGAGGTGGAG TGGTAGATTC
GCCACCACTA CCACCATTGC CTTTTTAAAA AAGCATTATG GATATTGGTA AGATTTAGTT TGAATATTTT GCAGATTTTA
GTTATCTCCG TAAACCAACT GTGATAGGTT TGAGTttagg atttgtatgt gatacatgaa aataatcagt agatttgtcc
tgagaagtac tttcagaata ttagtcttgt taggtttaac aaatatatat tacaataaaa attagctttc aaagctgtat
tttgaaggct CTACAAATGC TGAAAATGAC TTGTGACTTG CCTGTTTGCT TGGCAAGTTT AGGGTTTTCA GTGGCAAAAA
GGTTCCCCCA GAAAAGTTTA CCTTTTGCTT TATATTTTGT ATCAAACTAT GTAATGTTTG GCTTTCTATT AAAAGCCGGA
TCACTCAGTG ATCTGCTTTC TAAAAAAAAA TTGTGTTGCT GACTTGAATA GTAGTAGAGT AGCTGTGATA GATGAGGGCT
TCGACTAGGC CTATTAGAGG AACAGGGAGT GCAGAGAGAC ATGTAGATAA TTGATCTATT CTTGCCTTTG GAATGCAGGA
GATTATGGCC TGAGGATCCC TTGCAAAGTA CCTAATGGAG CACTGCATGC AACTCAAAGA TATTAGATAG ATATTTGAAT
ACAACTCAAT AATCAACTAC TAGATGATCT AATGCTGCTC TTAATGCTGT TGTTGCTGCT TCACTGCTCA TCGTTGGCCA
TGGCCTGCAA CCACGGCATT GTGATGTTAG CATACCCTAA CTTGGTGCTT CACAATCAAC TTCCCTTTGT GATTGACAAT
TTTATTAAGG CATGCTTTTG TTTCTTTTAT TTTTTTTCTC AATTTCATTC TATGAATATT AAAAGAAGCT CTTAATTTTT
CGGAATGTGA TTGATCATTC TTTTGCTGAC AATATGTTCA GATACTCGAA CAAAGTCCCT TGCTGTTTCC TCTATTTGTC
AGCCAAACAT TCATTATAAA TTTCAGCAGT CCTGACAAAT GATCTCTGTG CCACCAAGAC ACCAGTTCAA CTTACACAGA
ACAGAGTACA TGAGAACTGT AGTTGTGCTA AGGATATCCT CTAAACTTTA TGagcataag aacatattat attatagata
taataattaa aagaaggtaA TGGTGGTGAT GGCACTGTGG CGGTTGCGAA TTTGCCACCC CACCTATAGA ATGTCTTTTT
ATGACCCCTT CAACATGTCT TTTTATGAAT TTGCCACCCC ACTTATTGTA GATCTTGAGC ATGTTTATTT CTCCTTATTT
GCCTTACAAA GAAAAATAAA ATTCAGTATG GGAAGTTCCA AAATGGCCGA ACTGTCACAT ATAGATGGAC TTGTTTGGTG
CAAAAATCAT TTGTATATTT GGGCAATATT AGACTTTTTT TTTTTAAAAA AAAAAGGGTA GCAAGTGTAT TTGGTTGTTC
TGCAGAACAT TTGAAGGATT GCCTTGTCAG ATGCTCCAGT GTGTTTTGCC TTCAGTTTTA CTGGCCAATA GAACAGTCAT
GGAACTACTC ATTTGGTCTC TCGCTTTAGT GTTGGGTGTG AGCAACTGGA TTAACATTTG GAGCTACCAG TCTACCACTT
ATACATGATT TGTTCATGCT CACCGTTAGT CATCCTCTCG GGATTCAGCT TTTCCTAATG GTTACGGTAT TTTCATAATA
AAGGTGCAAT GAGGACAGAG AACGAAGTCC ACAATGAATT TGGAGATGCA CTTCTAGAGA GGGAGTCCAC TGCTGTTGTC
ACTATTTTCT TGCAGTCTGT CAAGAAGAGT TAAGAATCTG ATGATGAAGT TATTTATCTA GTGATCTGTG GGATTATTAG
ATGTTTGGAT GCTGATATCT TACTAAATTG GTGTACTTTG CACATGCAGA GGTGTATAAT GATTTATTCG TTTGCATGGT
TGTGTAAACA GGGTGAACGA CAGGAGCATT GGACTGTTCT TGCGCTATGC ATTCACTAGT AGGTACAAGG AGATACTAAG
CAAGTCACAC AGCTCTTCCA TGATGACAGT GCCCAAGTTT GTTCCGCGCC TTACAAAAGA AGAAGCTCAA GGTAAATACT
TCTCCCAACT CTGATTTTAC TCATCATCCT GCATTTCTTC CATTACCATT CCAAGCTCCC AACTATTATC ACTTCAAGTA
ACCCTTTTTT TTTCTGTCGC GAAGTGTTCG AATCTGCTAG GGACTCGATG ACCGCTTTCA AGAAGTGGCG CGCTGGCGGT
GTGAGGCTGC AGAAAGCGTC CATTCTTGGT AGGAAAAGGA AGACAAAACT GCCTGATGGA CCTTCTGCAC CTTGAACCAT
GTTTTAGGTT CTTCTGTATG GAAAATCGTA CTTGAGCTGA TGTATGTATA CTTCATTAAT ATGTCGCTGT AAGAGAAGAC
CAAAAGTGAA ACAATTCCGT TCGGAGATC

Locus: Os08g0274700

Loading...

Locus: Os08g0274700

Loading...