Os08t0281600-00

Locus

Os08g0281600

Description

F-box domain, cyclin-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFBX283, OsKIX_6, OsFbox434, Os_F0157

Oryzabase Gene Name Synonym(s)

KIX domain protein 6, F-box protein 283, F-box protein 434

Transcript Evidence

AK336057 (DDBJ)

Protein Evidence

B8B9B3 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

F-box domain, cyclin-like (IPR001810)

F-box domain, Skp2-like (IPR022364)

Expression Databases

TENOR (Os08t0281600-00)

Others

Oryzabase (13460)

Transcript

1134 bp

>Os08t0281600-00 F-box domain, cyclin-like domain containing protein.
ATGGATGTCTTTATTGCAGAACACTTGCTCGACCAAGTTCCTCCACGAAGCCAGAAGAAG
CTCTGCATGGATGACAGGCTAAGTGACCTTCCTGATACAATTCTACACCATATTATGTCT
CTCTTATCAGCACAGGAGGTTGCACGTACGTGTATCCTGTCCAAGAGATGGAAGGAGCTT
TCGGCCTCAGCACCATGCCTTGATATCTGTGTAGATAAGTTTGGAATGGACAGGGTGCGG
TTCAGTGAGTTTGTAGCACATTTGCTGCTATCCCGGGCTCCTAATTCACTGCATACATTT
CGTCTTCACTCTTTTGCAATCGACCATGCCAGCTCTTGGATCAATCGTGCAATTGAGCTC
AAGGCACAAGTGCTTGAATTCACCGAATATATAAGATGGGAATCTTTTTACTTGGATCCA
CAGCTTATGGCTTTTGCATCTCAATACCTGAAATGTTTGAAGCTCACCAATGTTACTCTA
GACTCCAATGCGTTTGAACCGCTAAACCATGCATGCCCAGCTTTGGAAAACCTTCAGTTG
TCACAGTGCTTCCTTGAGGTGCCTGAGATTTGTTCAGCTTCATTGAAGAAGTTGGATATT
ATGGAGTGTTCTCTTTTGATGAATCTTCAAATTCAGACCCCTCGCTTGGTCTCTTTACGC
TTCAGGTGTCTTCAATACAAATGTTCTTCATGCAGTAGGTATCCTGTAATTACAGCAGCA
GTGACTCTATGTGATCTTCCGAATGCCGAGAACATAGACTTGTCATGTTCTGGGAGACAG
GTTACATTTGGCAGAGAAATTCAAAAGTTCCCGATGTATGGCAAATTAACAAGCATCTCT
CTTGGTGAATGGTGTCTTTCTGACAAGTTCTCTCGATTATTTTGCCTCCTTCGACACTCA
CCTGAACTTAAGGAGCTTACTCTTAAGCTTGAGACCACAATGGAGAGGATGAGATTCGCT
TGATGGTGGGAAGATCATTTTCAGCCGAAAATCTTAAGAAGGTAACAATCTGTTGCGCGG
AAGGTGATGCAAGGGCCGCCATGTTGGGAAATATGTTCCGTGCGAATGCAACATCTCTCA
AGGAAATGCATATCAAACACTATTAGATGCTGAACAACGCTTGCCTTGTATCTG

CDS

963 bp

>Os08t0281600-00 F-box domain, cyclin-like domain containing protein.
ATGGATGTCTTTATTGCAGAACACTTGCTCGACCAAGTTCCTCCACGAAGCCAGAAGAAG
CTCTGCATGGATGACAGGCTAAGTGACCTTCCTGATACAATTCTACACCATATTATGTCT
CTCTTATCAGCACAGGAGGTTGCACGTACGTGTATCCTGTCCAAGAGATGGAAGGAGCTT
TCGGCCTCAGCACCATGCCTTGATATCTGTGTAGATAAGTTTGGAATGGACAGGGTGCGG
TTCAGTGAGTTTGTAGCACATTTGCTGCTATCCCGGGCTCCTAATTCACTGCATACATTT
CGTCTTCACTCTTTTGCAATCGACCATGCCAGCTCTTGGATCAATCGTGCAATTGAGCTC
AAGGCACAAGTGCTTGAATTCACCGAATATATAAGATGGGAATCTTTTTACTTGGATCCA
CAGCTTATGGCTTTTGCATCTCAATACCTGAAATGTTTGAAGCTCACCAATGTTACTCTA
GACTCCAATGCGTTTGAACCGCTAAACCATGCATGCCCAGCTTTGGAAAACCTTCAGTTG
TCACAGTGCTTCCTTGAGGTGCCTGAGATTTGTTCAGCTTCATTGAAGAAGTTGGATATT
ATGGAGTGTTCTCTTTTGATGAATCTTCAAATTCAGACCCCTCGCTTGGTCTCTTTACGC
TTCAGGTGTCTTCAATACAAATGTTCTTCATGCAGTAGGTATCCTGTAATTACAGCAGCA
GTGACTCTATGTGATCTTCCGAATGCCGAGAACATAGACTTGTCATGTTCTGGGAGACAG
GTTACATTTGGCAGAGAAATTCAAAAGTTCCCGATGTATGGCAAATTAACAAGCATCTCT
CTTGGTGAATGGTGTCTTTCTGACAAGTTCTCTCGATTATTTTGCCTCCTTCGACACTCA
CCTGAACTTAAGGAGCTTACTCTTAAGCTTGAGACCACAATGGAGAGGATGAGATTCGCT
TGA

Protein

321 aa

>Os08t0281600-00 F-box domain, cyclin-like domain containing protein.
MDVFIAEHLLDQVPPRSQKKLCMDDRLSDLPDTILHHIMSLLSAQEVARTCILSKRWKEL
SASAPCLDICVDKFGMDRVRFSEFVAHLLLSRAPNSLHTFRLHSFAIDHASSWINRAIEL
KAQVLEFTEYIRWESFYLDPQLMAFASQYLKCLKLTNVTLDSNAFEPLNHACPALENLQL
SQCFLEVPEICSASLKKLDIMECSLLMNLQIQTPRLVSLRFRCLQYKCSSCSRYPVITAA
VTLCDLPNAENIDLSCSGRQVTFGREIQKFPMYGKLTSISLGEWCLSDKFSRLFCLLRHS
PELKELTLKLETTMERMRFA*

CDS

chr08:11036509..11037288 (- strand) : 780 bp

chr08:11036253..11036405 (- strand) : 153 bp

chr08:11036102..11036131 (- strand) : 30 bp

3'UTR

chr08:11035931..11036101 (- strand) : 171 bp

FASTA

>Os08t0281600-00 class=Sequence position=chr08:11035931..11037288 (- strand)
ATGGATGTCT TTATTGCAGA ACACTTGCTC GACCAAGTTC CTCCACGAAG CCAGAAGAAG CTCTGCATGG ATGACAGGCT
AAGTGACCTT CCTGATACAA TTCTACACCA TATTATGTCT CTCTTATCAG CACAGGAGGT TGCACGTACG TGTATCCTGT
CCAAGAGATG GAAGGAGCTT TCGGCCTCAG CACCATGCCT TGATATCTGT GTAGATAAGT TTGGAATGGA CAGGGTGCGG
TTCAGTGAGT TTGTAGCACA TTTGCTGCTA TCCCGGGCTC CTAATTCACT GCATACATTT CGTCTTCACT CTTTTGCAAT
CGACCATGCC AGCTCTTGGA TCAATCGTGC AATTGAGCTC AAGGCACAAG TGCTTGAATT CACCGAATAT ATAAGATGGG
AATCTTTTTA CTTGGATCCA CAGCTTATGG CTTTTGCATC TCAATACCTG AAATGTTTGA AGCTCACCAA TGTTACTCTA
GACTCCAATG CGTTTGAACC GCTAAACCAT GCATGCCCAG CTTTGGAAAA CCTTCAGTTG TCACAGTGCT TCCTTGAGGT
GCCTGAGATT TGTTCAGCTT CATTGAAGAA GTTGGATATT ATGGAGTGTT CTCTTTTGAT GAATCTTCAA ATTCAGACCC
CTCGCTTGGT CTCTTTACGC TTCAGGTGTC TTCAATACAA ATGTTCTTCA TGCAGTAGGT ATCCTGTAAT TACAGCAGCA
GTGACTCTAT GTGATCTTCC GAATGCCGAG AACATAGACT TGTCATGTTC TGGGAGACAG GTATGATTGT GATGGTGTTT
TCACCCTCTT TACATTCTTT TCGCCTGAAT TATATCCGTG AAAACTGCAT TTATCTGTTG TATATTTTTT GTATGTTTGC
AAGGTTACAT TTGGCAGAGA AATTCAAAAG TTCCCGATGT ATGGCAAATT AACAAGCATC TCTCTTGGTG AATGGTGTCT
TTCTGACAAG TTCTCTCGAT TATTTTGCCT CCTTCGACAC TCACCTGAAC TTAAGGAGCT TACTCTTAAG CTTGAGGTGA
ACAATATCAT AGATGTATAG TTCTGGCTAT AAGATACTTT TCTCTTAGCA CATTACGCAA AGTCTTGGTG AAATGTTTTT
AAGTAGCACT TTTCCGAACT TCAGGTGGAA CGTCAAGACC ACAATGGAGA GGATGAGATT CGCTTGATGG TGGGAAGATC
ATTTTCAGCC GAAAATCTTA AGAAGGTAAC AATCTGTTGC GCGGAAGGTG ATGCAAGGGC CGCCATGTTG GGAAATATGT
TCCGTGCGAA TGCAACATCT CTCAAGGAAA TGCATATCAA ACACTATTAG ATGCTGAACA ACGCTTGCCT TGTATCTG

Locus: Os08g0281600

Loading...

Locus: Os08g0281600

Loading...