Os08t0286100-00

Locus

Os08g0286100

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPLL11, PLL11

Oryzabase Gene Name Synonym(s)

Pectate lyase-like 11

Transcript Evidence

BT087310 (DDBJ)

Protein Evidence

XP_002873391.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Pectate lyase/Amb allergen (IPR002022)

Pectin lyase fold/virulence factor (IPR011050)

Pectin lyase fold (IPR012334)

AmbAllergen (IPR018082)

Expression Databases

TENOR (Os08t0286100-00)

Others

Oryzabase (22496)

KEGG (Os08t0286100-00 (EC:4.2.2.2))

Transcript

1299 bp

>Os08t0286100-00 Similar to predicted protein.
ATGCTGTTAACAAACAATAACTCAGCAAAGCTGAAACTGTTTCCCTCCTTAAATGGAGAG
CACACGACGCATTTGAAATCTATAAGAGGTGTCAATTCTCCGCGCCAGCAAGATCGAGGT
CGAGCAAGCCCTTCCTCGATCATGGCCAACCGCAATGTACCAATGCTTCTGCCCCTCGCC
GTCCTCTTCCTCCTCGGCAGCGGCGGCGTCGCCACCGCCGcgaacgtgatcgaccggtgc
tggcgcggccagcgcaactgggccgccgaccggcagcgtctggccgtgtgctcggtgggc
ttcgccggcaagatgcggcagaaccgcggcgccggcgtggtcgcctacacggtcaccgac
ccgagcgacgaccccgtccggccgcggcccggcacgctccggtacggcgcgacggtgctg
ccggcgaaggtgtggatcaccttcgcgcgcgacatgcgcatcaggctggcccagccgctg
tacgtcaagaacttcaccaccatcgacggccgcggcgccgacgtgcacgtcgccggcggg
gccggcatcgtgctgtaccacgcgagggacgtgatcgtccacggcctccacgtgcacgac
tgccgcgcgcagccgccgggacgggtggtcgtcccgggtggcgccgtgcagccctccggc
agcggcgacggcgacgccatccgcctggtggcgagctccaaggtgtggatcgaccacaac
acgctgtcccgctgcgaggacggcctgctcgacgtcacggtcggctccaccgacgtcacc
gtctccaacAACTGGTTCCACGACCACGACAAGGTGATGCTCCTCGGCCACGACGACGGC
TTCACCACCGACCGCCGCATGCGCGTCACCGTCGCCTTCAACCGCTTCGGCCCAAACGTC
AACCAGCGCATGCCAAGGATAAGGCACGGGTACGCGCACGTGGTGAACAACCTGTACGAT
GGGTGGAGGGACTACGCCATTGGAGGGAGCATGGGGCCGAGCGTGAAGAGCCAGGGCAAC
CTGTTCGCGGCGTCGGGCGGCGCCGGCGACAACAAGAAGGTGACGAGGAGGATGCCGGCC
GTGGCGCGCGGCGGCGGCGGCGGCGGGAAGGATCAGTGGCACTTGCACTCGGTCGGCGAC
GCCTTCGAGAACGGCGCGTTCTTCCGGCAGGTGGGCAACAGGGTGCGGCCCAACTACAAT
CGGCACCAGGCCTTCTCGGCGGCGAGCGCCGGCGACGTAAGGGCGCTCACCGGCGGCGTC
GGCGCTCTCACGTGCTCTGCCACGGCGGCGTGCTGACAA

CDS

1296 bp

>Os08t0286100-00 Similar to predicted protein.
ATGCTGTTAACAAACAATAACTCAGCAAAGCTGAAACTGTTTCCCTCCTTAAATGGAGAG
CACACGACGCATTTGAAATCTATAAGAGGTGTCAATTCTCCGCGCCAGCAAGATCGAGGT
CGAGCAAGCCCTTCCTCGATCATGGCCAACCGCAATGTACCAATGCTTCTGCCCCTCGCC
GTCCTCTTCCTCCTCGGCAGCGGCGGCGTCGCCACCGCCGcgaacgtgatcgaccggtgc
tggcgcggccagcgcaactgggccgccgaccggcagcgtctggccgtgtgctcggtgggc
ttcgccggcaagatgcggcagaaccgcggcgccggcgtggtcgcctacacggtcaccgac
ccgagcgacgaccccgtccggccgcggcccggcacgctccggtacggcgcgacggtgctg
ccggcgaaggtgtggatcaccttcgcgcgcgacatgcgcatcaggctggcccagccgctg
tacgtcaagaacttcaccaccatcgacggccgcggcgccgacgtgcacgtcgccggcggg
gccggcatcgtgctgtaccacgcgagggacgtgatcgtccacggcctccacgtgcacgac
tgccgcgcgcagccgccgggacgggtggtcgtcccgggtggcgccgtgcagccctccggc
agcggcgacggcgacgccatccgcctggtggcgagctccaaggtgtggatcgaccacaac
acgctgtcccgctgcgaggacggcctgctcgacgtcacggtcggctccaccgacgtcacc
gtctccaacAACTGGTTCCACGACCACGACAAGGTGATGCTCCTCGGCCACGACGACGGC
TTCACCACCGACCGCCGCATGCGCGTCACCGTCGCCTTCAACCGCTTCGGCCCAAACGTC
AACCAGCGCATGCCAAGGATAAGGCACGGGTACGCGCACGTGGTGAACAACCTGTACGAT
GGGTGGAGGGACTACGCCATTGGAGGGAGCATGGGGCCGAGCGTGAAGAGCCAGGGCAAC
CTGTTCGCGGCGTCGGGCGGCGCCGGCGACAACAAGAAGGTGACGAGGAGGATGCCGGCC
GTGGCGCGCGGCGGCGGCGGCGGCGGGAAGGATCAGTGGCACTTGCACTCGGTCGGCGAC
GCCTTCGAGAACGGCGCGTTCTTCCGGCAGGTGGGCAACAGGGTGCGGCCCAACTACAAT
CGGCACCAGGCCTTCTCGGCGGCGAGCGCCGGCGACGTAAGGGCGCTCACCGGCGGCGTC
GGCGCTCTCACGTGCTCTGCCACGGCGGCGTGCTGA

Protein

431 aa

>Os08t0286100-00 Similar to predicted protein.
MLLTNNNSAKLKLFPSLNGEHTTHLKSIRGVNSPRQQDRGRASPSSIMANRNVPMLLPLA
VLFLLGSGGVATAANVIDRCWRGQRNWAADRQRLAVCSVGFAGKMRQNRGAGVVAYTVTD
PSDDPVRPRPGTLRYGATVLPAKVWITFARDMRIRLAQPLYVKNFTTIDGRGADVHVAGG
AGIVLYHARDVIVHGLHVHDCRAQPPGRVVVPGGAVQPSGSGDGDAIRLVASSKVWIDHN
TLSRCEDGLLDVTVGSTDVTVSNNWFHDHDKVMLLGHDDGFTTDRRMRVTVAFNRFGPNV
NQRMPRIRHGYAHVVNNLYDGWRDYAIGGSMGPSVKSQGNLFAASGGAGDNKKVTRRMPA
VARGGGGGGKDQWHLHSVGDAFENGAFFRQVGNRVRPNYNRHQAFSAASAGDVRALTGGV
GALTCSATAAC*

CDS

chr08:11310539..11311455 (+ strand) : 917 bp

chr08:11311563..11311941 (+ strand) : 379 bp

3'UTR

chr08:11311942..11311944 (+ strand) : 3 bp

FASTA

>Os08t0286100-00 class=Sequence position=chr08:11310539..11311944 (+ strand)
ATGCTGTTAA CAAACAATAA CTCAGCAAAG CTGAAACTGT TTCCCTCCTT AAATGGAGAG CACACGACGC ATTTGAAATC
TATAAGAGGT GTCAATTCTC CGCGCCAGCA AGATCGAGGT CGAGCAAGCC CTTCCTCGAT CATGGCCAAC CGCAATGTAC
CAATGCTTCT GCCCCTCGCC GTCCTCTTCC TCCTCGGCAG CGGCGGCGTC GCCACCGCCG cgaacgtgat cgaccggtgc
tggcgcggcc agcgcaactg ggccgccgac cggcagcgtc tggccgtgtg ctcggtgggc ttcgccggca agatgcggca
gaaccgcggc gccggcgtgg tcgcctacac ggtcaccgac ccgagcgacg accccgtccg gccgcggccc ggcacgctcc
ggtacggcgc gacggtgctg ccggcgaagg tgtggatcac cttcgcgcgc gacatgcgca tcaggctggc ccagccgctg
tacgtcaaga acttcaccac catcgacggc cgcggcgccg acgtgcacgt cgccggcggg gccggcatcg tgctgtacca
cgcgagggac gtgatcgtcc acggcctcca cgtgcacgac tgccgcgcgc agccgccggg acgggtggtc gtcccgggtg
gcgccgtgca gccctccggc agcggcgacg gcgacgccat ccgcctggtg gcgagctcca aggtgtggat cgaccacaac
acgctgtccc gctgcgagga cggcctgctc gacgtcacgg tcggctccac cgacgtcacc gtctccaacA ACTGGTTCCA
CGACCACGAC AAGGTGATGC TCCTCGGCCA CGACGACGGC TTCACCACCG ACCGCCGCAT GCGCGTCACC GTCGCCTTCA
ACCGCTTCGG CCCAAACGTC AACCAGCGCA TGCCAAGGTA TAGCCACTAG CCACACACCC GGCCATGAAT AATCCGCCAC
TGGAGGAGCT CGTGCTCGAG CTCGACATCG ATCGAACACC TGCTTGGCAT TACATTGGAT GCAGGATAAG GCACGGGTAC
GCGCACGTGG TGAACAACCT GTACGATGGG TGGAGGGACT ACGCCATTGG AGGGAGCATG GGGCCGAGCG TGAAGAGCCA
GGGCAACCTG TTCGCGGCGT CGGGCGGCGC CGGCGACAAC AAGAAGGTGA CGAGGAGGAT GCCGGCCGTG GCGCGCGGCG
GCGGCGGCGG CGGGAAGGAT CAGTGGCACT TGCACTCGGT CGGCGACGCC TTCGAGAACG GCGCGTTCTT CCGGCAGGTG
GGCAACAGGG TGCGGCCCAA CTACAATCGG CACCAGGCCT TCTCGGCGGC GAGCGCCGGC GACGTAAGGG CGCTCACCGG
CGGCGTCGGC GCTCTCACGT GCTCTGCCAC GGCGGCGTGC TGACAA

Locus: Os08g0286100

Loading...

Locus: Os08g0286100

Loading...