Os08t0292600-01

Locus

Os08g0292600

Description

Similar to Peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP28

CGSNL Gene Name

CYCLOPHILIN 28

Oryzabase Gene Symbol Synonym(s)

OsCYP28, OsCYP-21, OsCYP28a, OsCYP28b, OsCYP28c, OsCYP28d

Oryzabase Gene Name Synonym(s)

cyclophilin 28, cyclophilin 21

Transcript Evidence

AK121304 (DDBJ, Best hit)

Protein Evidence

B4FFW0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Full-length cDNA

J023111F24 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0292600-01)

RiceXPro (AK121304)

Others

Oryzabase (10067)

KEGG (Os08t0292600-01)

Transcript

3303 bp

>Os08t0292600-01 Similar to Peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein.
AGCCGGCACAATTCCCATGTAAAAGGGATATtgagataagggcggagtaatcgagtatcg
cgtaaaagaagaaatctcccgtctcgttctcgttctcctccgctccttgcgccgccgcca
agacgagcggagggccgggcggcgatctccatctggcaagcagagcagcggaggggagga
ggggatcctggtgcgtcctctttctgatccatctctctctctctctctctctctctctcc
caccccaccgggacctggaatttgcttgcgttcgtgaatttgatagccttaaacctctct
tatttcaagtaataacagtttgtttgtttacctaaaagttcgggggttcaaccgaacccc
catgccccaagttggatccgcccctgGTTTGAATTGCTGAAACATAATTTCGAGCTAGTT
AAACGAAGAGACAACATGCCTGGAAATGTAAAAAAAAAGTATGCTGATTTGAATTTGATT
GTTGGAACTGCCCTATAGGAAACTGGTAAATTTTAGAACAAAAAACCTTGCTTATAGTAA
AATCGTGAATGGATGATATGCAAAGACATGGTGAGAAATATTCACTCGCTCATACTACAA
CTACTTAAGAGGACCATATTTGCTCACTCTGGAATAGCTGCTGACCTGCTGTGACCATCA
TACACCCCCTCACCGCAATGCAGGTTCCATTTGAAGTAATCGGAGAATGGTATGTTGAGA
ATTAGATTAAAGCTTCCATTTTAAAATTGTAATTGTTTGGGCTGTCAGCTATTTGCCATT
ATTCACAAGTGATAATTGTGACCCTACAACGAAGAGGCTAACAGTAGGTTTTAGAATTTC
AGTAATGTTATATCTCAAAAGCCAACTATTACATTTGCAGGGAAGGATATTAGTGATTTT
CTACTGCTGTTTCGTCAGAAGGACAAGAACTGAAGAATTCAGTTAGCAACAGTATGGTGT
TGCCTTCATCAAATACCAGGGCCACTTCTTCCATGGCTTACCCTGTTTCCCTGAGCAGCC
TCCACCACCACCCCAACAACCACCATGCTTTTTTTCTTCCCTCGAAAACAAACCATGATA
ATACTCATAAACCTATTGAATCCTCTAGAATTTCTAGACGGTCTCTCATCTTCCTCCCTG
TCCTCCCTTCTCTTCTATACGCTTCATCATCCCCTGCCTTAGATGACGCAAACATTCCAT
CCACCTCTGCCATTGATACCACCATCACAGATCGGATCTTCATGGACTTCAGTGTCTGCC
CTAGCTACTTTCGCTCTGACCGCACTTTAGGAGCTGAGCTTGCTACATGTCCTGATTCTG
AACCTCTTGGTCGTGTAATTTTTGGTTTGTATGGTCGACTCCTCCCCCTCACTACTGCCA
ACTTCAAAGCTGCTTGCACTTCTGCTGCATACCGGGGAACACTTGTCCACAAGCTCCTTC
AGGGCCAGTTCTTCGTTGCTGGCCGCCAAGGTCCTCGGCGTGACAGGGGCGAGGTCCAAC
CTCCCACCGGACTTGTGAGGAATGCTGAGACTATTGACCCTAAAGCATTTGAACTAAAGC
ATGCAAGGCCTGGCACCCTCTCATTGTGCCTTGGACAGAACGATGACGATGATGACATCA
AGCTCAATCCTAATTATCACAATGTTGAATTCTTGGTTACCACTGGACCAGGGCCCTGCC
CAGAGCTTGATGGACAGAACATTGTCTTTGGAACTGTATTGGAAGGTTAGTTGCTTTCAT
TTTCTGAACTTTTACTAAATGGTTCTTGCACACTTTGTGTTAAATTCTGTCTTGCAAGAA
TTTCAATGTCTTTCCCTCGAACAAGTTGGGATTTGACCTGTGCGTAATCTACTAATGCAA
GGTTGGCATGATTAAATTCATGCATAAATCTATTTTCTTTGGTTCAAACAGAGAAAAATA
AAATGTATTTCAAACCGTTTCATTTTTTGTCAAGTATAATTATATGACATCTTCCATTCT
CCTTTTGGTATAGTTATATACACTTGCTAAGGTAAACATGTTTTCATTGAAGTAATCAAC
ATTAGTACATAACAGAGAAGAAAAAAAATGCAAATTTTGCAGCTTTGCATGAGTATTAAC
AAAATAACAAACAGTTGTGTCCGTATTCTGGCTAGGACTTCATCCATGCAGAACATAAAG
TTAGATGTTTTATTATTACCAATTTCTGCAAGTAATATAAGCTTGTAAAGAAATTGTCAT
TTTATTTCTTCCTTTTTGTTGTCTCAACACCAAGGATGGTTATCACACTAAGATTAATTC
TTTTTTTTTTCTTCTCTGCACTTCACCACAGTATAACTCATCATCAATTCCTGCCATGGT
TTGTTCTAACAATGTGCCACATTGTCAATAAACAACACCAGAGAGTGTATCATCCTCATA
TAGTCAAATTTGGTGCATACTTCATTGTTTTTCCCTGTTCTGATTTATTAGATCTCTGGT
GGTTATCAGAAGTAGATTGAACTAAACCAAGCAACTCATCAATGAGATTTATACTGCCAC
TGAACATGTCACCCCAAAAGAGAATCTACTTCTAGCTAATTTAAGACTGACATGTCTGCT
TTGACAGTTTGATTTGTAATTTAATAAACTTTACAACAACAACCAGGGCAGTAGTTAACT
ACAAAGCAGTTCATATTTAAGTTTTATGCATCAAGAACTTAAAAGCACGGCCCTTCTATC
CCCAAAAAAGCACATGCCCACGTTCTGCATCTGCATGCCCATGCGGCATGCTCTCATGCA
CATGCATGGGCAGACGCAACAAATGCATGCGCACATACAACTATATAACTTATATTCACA
TGACACTTGAGGCACACTAATGCTTGTCATTAGGACCCATTGCCACTTGAAGTGTAATAG
TGTTACTCATTTGAACTGAACTAGCTACTTAGTCTCAGTTTCAGTATTTGATTATTACCA
ACAGTTTTTTCTTAAGCATCCATTTTTCTTCTTCTATAAGCAACTTTGATTGTCAAGTTC
TGCATTCACATGCACACATAGGCGACTAAAACAGACTTTCAAGCACTGAGTTAAACAAGT
GTATTAATTGGATATATTCCAGTGGAATTGACATGAAGCTTCAATTTTGTACGAGTTGCT
TTCTGTTGTCTTAATGGAAACTAGTATTGCCACTGTATGATTAATGATGATATTGTTGAT
TCAGATTAACAGAAAGCGGCTAATTCGAAAGATTTTACATGATAATTTGTACATATGTAA
TTTGTAACTATTATATAGTTTTAATATATCGCAGTAGCAGTCTCTCCTGCTGTTTTCATC
GTC

CDS

777 bp

>Os08t0292600-01 Similar to Peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein.
ATGGTGTTGCCTTCATCAAATACCAGGGCCACTTCTTCCATGGCTTACCCTGTTTCCCTG
AGCAGCCTCCACCACCACCCCAACAACCACCATGCTTTTTTTCTTCCCTCGAAAACAAAC
CATGATAATACTCATAAACCTATTGAATCCTCTAGAATTTCTAGACGGTCTCTCATCTTC
CTCCCTGTCCTCCCTTCTCTTCTATACGCTTCATCATCCCCTGCCTTAGATGACGCAAAC
ATTCCATCCACCTCTGCCATTGATACCACCATCACAGATCGGATCTTCATGGACTTCAGT
GTCTGCCCTAGCTACTTTCGCTCTGACCGCACTTTAGGAGCTGAGCTTGCTACATGTCCT
GATTCTGAACCTCTTGGTCGTGTAATTTTTGGTTTGTATGGTCGACTCCTCCCCCTCACT
ACTGCCAACTTCAAAGCTGCTTGCACTTCTGCTGCATACCGGGGAACACTTGTCCACAAG
CTCCTTCAGGGCCAGTTCTTCGTTGCTGGCCGCCAAGGTCCTCGGCGTGACAGGGGCGAG
GTCCAACCTCCCACCGGACTTGTGAGGAATGCTGAGACTATTGACCCTAAAGCATTTGAA
CTAAAGCATGCAAGGCCTGGCACCCTCTCATTGTGCCTTGGACAGAACGATGACGATGAT
GACATCAAGCTCAATCCTAATTATCACAATGTTGAATTCTTGGTTACCACTGGACCAGGG
CCCTGCCCAGAGCTTGATGGACAGAACATTGTCTTTGGAACTGTATTGGAAGGTTAG

Protein

259 aa

>Os08t0292600-01 Similar to Peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein.
MVLPSSNTRATSSMAYPVSLSSLHHHPNNHHAFFLPSKTNHDNTHKPIESSRISRRSLIF
LPVLPSLLYASSSPALDDANIPSTSAIDTTITDRIFMDFSVCPSYFRSDRTLGAELATCP
DSEPLGRVIFGLYGRLLPLTTANFKAACTSAAYRGTLVHKLLQGQFFVAGRQGPRRDRGE
VQPPTGLVRNAETIDPKAFELKHARPGTLSLCLGQNDDDDDIKLNPNYHNVEFLVTTGPG
PCPELDGQNIVFGTVLEG*

5'UTR

chr08:11728223..11729175 (+ strand) : 953 bp

CDS

chr08:11729176..11729952 (+ strand) : 777 bp

3'UTR

chr08:11729953..11731525 (+ strand) : 1573 bp

FASTA

>Os08t0292600-01 class=Sequence position=chr08:11728223..11731525 (+ strand)
AGCCGGCACA ATTCCCATGT AAAAGGGATA Ttgagataag ggcggagtaa tcgagtatcg cgtaaaagaa gaaatctccc
gtctcgttct cgttctcctc cgctccttgc gccgccgcca agacgagcgg agggccgggc ggcgatctcc atctggcaag
cagagcagcg gaggggagga ggggatcctg gtgcgtcctc tttctgatcc atctctctct ctctctctct ctctctctcc
caccccaccg ggacctggaa tttgcttgcg ttcgtgaatt tgatagcctt aaacctctct tatttcaagt aataacagtt
tgtttgttta cctaaaagtt cgggggttca accgaacccc catgccccaa gttggatccg cccctgGTTT GAATTGCTGA
AACATAATTT CGAGCTAGTT AAACGAAGAG ACAACATGCC TGGAAATGTA AAAAAAAAGT ATGCTGATTT GAATTTGATT
GTTGGAACTG CCCTATAGGA AACTGGTAAA TTTTAGAACA AAAAACCTTG CTTATAGTAA AATCGTGAAT GGATGATATG
CAAAGACATG GTGAGAAATA TTCACTCGCT CATACTACAA CTACTTAAGA GGACCATATT TGCTCACTCT GGAATAGCTG
CTGACCTGCT GTGACCATCA TACACCCCCT CACCGCAATG CAGGTTCCAT TTGAAGTAAT CGGAGAATGG TATGTTGAGA
ATTAGATTAA AGCTTCCATT TTAAAATTGT AATTGTTTGG GCTGTCAGCT ATTTGCCATT ATTCACAAGT GATAATTGTG
ACCCTACAAC GAAGAGGCTA ACAGTAGGTT TTAGAATTTC AGTAATGTTA TATCTCAAAA GCCAACTATT ACATTTGCAG
GGAAGGATAT TAGTGATTTT CTACTGCTGT TTCGTCAGAA GGACAAGAAC TGAAGAATTC AGTTAGCAAC AGTATGGTGT
TGCCTTCATC AAATACCAGG GCCACTTCTT CCATGGCTTA CCCTGTTTCC CTGAGCAGCC TCCACCACCA CCCCAACAAC
CACCATGCTT TTTTTCTTCC CTCGAAAACA AACCATGATA ATACTCATAA ACCTATTGAA TCCTCTAGAA TTTCTAGACG
GTCTCTCATC TTCCTCCCTG TCCTCCCTTC TCTTCTATAC GCTTCATCAT CCCCTGCCTT AGATGACGCA AACATTCCAT
CCACCTCTGC CATTGATACC ACCATCACAG ATCGGATCTT CATGGACTTC AGTGTCTGCC CTAGCTACTT TCGCTCTGAC
CGCACTTTAG GAGCTGAGCT TGCTACATGT CCTGATTCTG AACCTCTTGG TCGTGTAATT TTTGGTTTGT ATGGTCGACT
CCTCCCCCTC ACTACTGCCA ACTTCAAAGC TGCTTGCACT TCTGCTGCAT ACCGGGGAAC ACTTGTCCAC AAGCTCCTTC
AGGGCCAGTT CTTCGTTGCT GGCCGCCAAG GTCCTCGGCG TGACAGGGGC GAGGTCCAAC CTCCCACCGG ACTTGTGAGG
AATGCTGAGA CTATTGACCC TAAAGCATTT GAACTAAAGC ATGCAAGGCC TGGCACCCTC TCATTGTGCC TTGGACAGAA
CGATGACGAT GATGACATCA AGCTCAATCC TAATTATCAC AATGTTGAAT TCTTGGTTAC CACTGGACCA GGGCCCTGCC
CAGAGCTTGA TGGACAGAAC ATTGTCTTTG GAACTGTATT GGAAGGTTAG TTGCTTTCAT TTTCTGAACT TTTACTAAAT
GGTTCTTGCA CACTTTGTGT TAAATTCTGT CTTGCAAGAA TTTCAATGTC TTTCCCTCGA ACAAGTTGGG ATTTGACCTG
TGCGTAATCT ACTAATGCAA GGTTGGCATG ATTAAATTCA TGCATAAATC TATTTTCTTT GGTTCAAACA GAGAAAAATA
AAATGTATTT CAAACCGTTT CATTTTTTGT CAAGTATAAT TATATGACAT CTTCCATTCT CCTTTTGGTA TAGTTATATA
CACTTGCTAA GGTAAACATG TTTTCATTGA AGTAATCAAC ATTAGTACAT AACAGAGAAG AAAAAAAATG CAAATTTTGC
AGCTTTGCAT GAGTATTAAC AAAATAACAA ACAGTTGTGT CCGTATTCTG GCTAGGACTT CATCCATGCA GAACATAAAG
TTAGATGTTT TATTATTACC AATTTCTGCA AGTAATATAA GCTTGTAAAG AAATTGTCAT TTTATTTCTT CCTTTTTGTT
GTCTCAACAC CAAGGATGGT TATCACACTA AGATTAATTC TTTTTTTTTT CTTCTCTGCA CTTCACCACA GTATAACTCA
TCATCAATTC CTGCCATGGT TTGTTCTAAC AATGTGCCAC ATTGTCAATA AACAACACCA GAGAGTGTAT CATCCTCATA
TAGTCAAATT TGGTGCATAC TTCATTGTTT TTCCCTGTTC TGATTTATTA GATCTCTGGT GGTTATCAGA AGTAGATTGA
ACTAAACCAA GCAACTCATC AATGAGATTT ATACTGCCAC TGAACATGTC ACCCCAAAAG AGAATCTACT TCTAGCTAAT
TTAAGACTGA CATGTCTGCT TTGACAGTTT GATTTGTAAT TTAATAAACT TTACAACAAC AACCAGGGCA GTAGTTAACT
ACAAAGCAGT TCATATTTAA GTTTTATGCA TCAAGAACTT AAAAGCACGG CCCTTCTATC CCCAAAAAAG CACATGCCCA
CGTTCTGCAT CTGCATGCCC ATGCGGCATG CTCTCATGCA CATGCATGGG CAGACGCAAC AAATGCATGC GCACATACAA
CTATATAACT TATATTCACA TGACACTTGA GGCACACTAA TGCTTGTCAT TAGGACCCAT TGCCACTTGA AGTGTAATAG
TGTTACTCAT TTGAACTGAA CTAGCTACTT AGTCTCAGTT TCAGTATTTG ATTATTACCA ACAGTTTTTT CTTAAGCATC
CATTTTTCTT CTTCTATAAG CAACTTTGAT TGTCAAGTTC TGCATTCACA TGCACACATA GGCGACTAAA ACAGACTTTC
AAGCACTGAG TTAAACAAGT GTATTAATTG GATATATTCC AGTGGAATTG ACATGAAGCT TCAATTTTGT ACGAGTTGCT
TTCTGTTGTC TTAATGGAAA CTAGTATTGC CACTGTATGA TTAATGATGA TATTGTTGAT TCAGATTAAC AGAAAGCGGC
TAATTCGAAA GATTTTACAT GATAATTTGT ACATATGTAA TTTGTAACTA TTATATAGTT TTAATATATC GCAGTAGCAG
TCTCTCCTGC TGTTTTCATC GTC

Locus: Os08g0292600

Loading...

Locus: Os08g0292600

Loading...