Os08t0292600-02

Locus

Os08g0292600

Description

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP28

CGSNL Gene Name

CYCLOPHILIN 28

Oryzabase Gene Symbol Synonym(s)

OsCYP28, OsCYP-21, OsCYP28a, OsCYP28b, OsCYP28c, OsCYP28d

Oryzabase Gene Name Synonym(s)

cyclophilin 28, cyclophilin 21

Transcript Evidence

AK070751 (DDBJ, Best hit)

Protein Evidence

B4FFW0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Full-length cDNA

J023064N17 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0292600-02)

RiceXPro (AK070751)

Others

Oryzabase (10067)

KEGG (Os08t0292600-02 (EC:5.2.1.8))

Transcript

2051 bp

>Os08t0292600-02 Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.
aatcgagtatcgcgtaaaagaagaaatctcccgtctcgttctcgttctcctccgctcctt
gcgccgccgccaagacgagcggagggccgggcggcgatctccatctggcaagcagagcag
cggaggggaggaggggatcctggtgcgtcctctttctgatccatctctctctctctctct
ctctctctctcccaccccaccgggacctggaatttgcttgcgttcgtgaatttgatagcc
ttaaacctctcttatttcaagtaataacagtttgtttgtttacctaaaagttcgggggtt
caaccgaacccccatgccccaagttggatccgcccctgGTTTGAATTGCTGAAACATAAT
TTCGAGCTAGTTAAACGAAGAGACAACATGCCTGGAAATGTAAAAAAAAAGTATGCTGAT
TTGAATTTGATTGTTGGAACTGCCCTATAGGAAACTGGTAAATTTTAGAACAAAAAACCT
TGCTTATAGTAAAATCGTGAATGGATGATATGCAAAGACATGGTGAGAAATATTCACTCG
CTCATACTACAACTACTTAAGAGGACCATATTTGCTCACTCTGGAATAGCTGCTGACCTG
CTGTGACCATCATACACCCCCTCACCGCAATGCAGGTTCCATTTGAAGTAATCGGAGAAT
GGTATGTTGAGAATTAGATTAAAGCTTCCATTTTAAAATTGTAATTGTTTGGGCTGTCAG
CTATTTGCCATTATTCACAAGTGATAATTGTGACCCTACAACGAAGAGGCTAACAGTAGG
TTTTAGAATTTCAGTAATGTTATATCTCAAAAGCCAACTATTACATTTGCAGGGAAGGAT
ATTAGTGATTTTCTACTGCTGTTTCGTCAGAAGGACAAGAACTGAAGAATTCAGTTAGCA
ACAGTATGGTGTTGCCTTCATCAAATACCAGGGCCACTTCTTCCATGGCTTACCCTGTTT
CCCTGAGCAGCCTCCACCACCACCCCAACAACCACCATGCTTTTTTTCTTCCCTCGAAAA
CAAACCATGATAATACTCATAAACCTATTGAATCCTCTAGAATTTCTAGACGGTCTCTCA
TCTTCCTCCCTGTCCTCCCTTCTCTTCTATACGCTTCATCATCCCCTGCCTTAGATGACG
CAAACATTCCATCCACCTCTGCCATTGATACCACCATCACAGATCGGATCTTCATGGACT
TCAGTGTCTGCCCTAGCTACTTTCGCTCTGACCGCACTTTAGGAGCTGAGCTTGCTACAT
GTCCTGATTCTGAACCTCTTGGTCGTGTAATTTTTGGTTTGTATGGTCGACTCCTCCCCC
TCACTACTGCCAACTTCAAAGCTGCTTGCACTTCTGCTGCATACCGGGGAACACTTGTCC
ACAAGCTCCTTCAGGGCCAGTTCTTCGTTGCTGGCCGCCAAGGTCCTCGGCGTGACAGGG
GCGAGGTCCAACCTCCCACCGGACTTGTGAGGAATGCTGAGACTATTGACCCTAAAGCAT
TTGAACTAAAGCATGCAAGGCCTGGCACCCTCTCATTGTGCCTTGGACAGAACGATGACG
ATGATGACATCAAGCTCAATCCTAATTATCACAATGTTGAATTCTTGGTTACCACTGGAC
CAGGGCCCTGCCCAGAGCTTGATGGACAGAACATTGTCTTTGGAACTGTATTGGAAGGAA
TGAATGTTATAACCAGCATTGCAACTATTCCTACCTATAAACCAGCTGAAAGGATCCGCT
TCTTCAATGATTTTGCCCAGTTGATTGGTGATGAAAGAGCTCAAACTGCTCGAGCGTTGT
GGGATCGCCCGCTAAAAACTGTTTATATCAGTGATTGCGGAGAGCTAAAAGTGACCAAAC
CATCACTTTCCCCTCCAAGTCTGCCATAAAAAACCACAGAGGCAATTTTGTGTACCTACA
CTTATTCTTCTCCCTCCAATGTCAACTGTATATATGCCATCTAGTATTAACTGACATCTG
CTGTGTTTCTGGCCCAAAATGTGTACGACGGGTCTCTGATTCATCGAAGTAAATATATTA
CAGTGCTGTGC

CDS

984 bp

>Os08t0292600-02 Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.
ATGGTGTTGCCTTCATCAAATACCAGGGCCACTTCTTCCATGGCTTACCCTGTTTCCCTG
AGCAGCCTCCACCACCACCCCAACAACCACCATGCTTTTTTTCTTCCCTCGAAAACAAAC
CATGATAATACTCATAAACCTATTGAATCCTCTAGAATTTCTAGACGGTCTCTCATCTTC
CTCCCTGTCCTCCCTTCTCTTCTATACGCTTCATCATCCCCTGCCTTAGATGACGCAAAC
ATTCCATCCACCTCTGCCATTGATACCACCATCACAGATCGGATCTTCATGGACTTCAGT
GTCTGCCCTAGCTACTTTCGCTCTGACCGCACTTTAGGAGCTGAGCTTGCTACATGTCCT
GATTCTGAACCTCTTGGTCGTGTAATTTTTGGTTTGTATGGTCGACTCCTCCCCCTCACT
ACTGCCAACTTCAAAGCTGCTTGCACTTCTGCTGCATACCGGGGAACACTTGTCCACAAG
CTCCTTCAGGGCCAGTTCTTCGTTGCTGGCCGCCAAGGTCCTCGGCGTGACAGGGGCGAG
GTCCAACCTCCCACCGGACTTGTGAGGAATGCTGAGACTATTGACCCTAAAGCATTTGAA
CTAAAGCATGCAAGGCCTGGCACCCTCTCATTGTGCCTTGGACAGAACGATGACGATGAT
GACATCAAGCTCAATCCTAATTATCACAATGTTGAATTCTTGGTTACCACTGGACCAGGG
CCCTGCCCAGAGCTTGATGGACAGAACATTGTCTTTGGAACTGTATTGGAAGGAATGAAT
GTTATAACCAGCATTGCAACTATTCCTACCTATAAACCAGCTGAAAGGATCCGCTTCTTC
AATGATTTTGCCCAGTTGATTGGTGATGAAAGAGCTCAAACTGCTCGAGCGTTGTGGGAT
CGCCCGCTAAAAACTGTTTATATCAGTGATTGCGGAGAGCTAAAAGTGACCAAACCATCA
CTTTCCCCTCCAAGTCTGCCATAA

Protein

328 aa

>Os08t0292600-02 Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.
MVLPSSNTRATSSMAYPVSLSSLHHHPNNHHAFFLPSKTNHDNTHKPIESSRISRRSLIF
LPVLPSLLYASSSPALDDANIPSTSAIDTTITDRIFMDFSVCPSYFRSDRTLGAELATCP
DSEPLGRVIFGLYGRLLPLTTANFKAACTSAAYRGTLVHKLLQGQFFVAGRQGPRRDRGE
VQPPTGLVRNAETIDPKAFELKHARPGTLSLCLGQNDDDDDIKLNPNYHNVEFLVTTGPG
PCPELDGQNIVFGTVLEGMNVITSIATIPTYKPAERIRFFNDFAQLIGDERAQTARALWD
RPLKTVYISDCGELKVTKPSLSPPSLP*

5'UTR

chr08:11728271..11729175 (+ strand) : 905 bp

CDS

chr08:11729176..11729947 (+ strand) : 772 bp

chr08:11732664..11732875 (+ strand) : 212 bp

3'UTR

chr08:11732876..11733037 (+ strand) : 162 bp

FASTA

>Os08t0292600-02 class=Sequence position=chr08:11728271..11733037 (+ strand)
aatcgagtat cgcgtaaaag aagaaatctc ccgtctcgtt ctcgttctcc tccgctcctt gcgccgccgc caagacgagc
ggagggccgg gcggcgatct ccatctggca agcagagcag cggaggggag gaggggatcc tggtgcgtcc tctttctgat
ccatctctct ctctctctct ctctctctct cccaccccac cgggacctgg aatttgcttg cgttcgtgaa tttgatagcc
ttaaacctct cttatttcaa gtaataacag tttgtttgtt tacctaaaag ttcgggggtt caaccgaacc cccatgcccc
aagttggatc cgcccctgGT TTGAATTGCT GAAACATAAT TTCGAGCTAG TTAAACGAAG AGACAACATG CCTGGAAATG
TAAAAAAAAA GTATGCTGAT TTGAATTTGA TTGTTGGAAC TGCCCTATAG GAAACTGGTA AATTTTAGAA CAAAAAACCT
TGCTTATAGT AAAATCGTGA ATGGATGATA TGCAAAGACA TGGTGAGAAA TATTCACTCG CTCATACTAC AACTACTTAA
GAGGACCATA TTTGCTCACT CTGGAATAGC TGCTGACCTG CTGTGACCAT CATACACCCC CTCACCGCAA TGCAGGTTCC
ATTTGAAGTA ATCGGAGAAT GGTATGTTGA GAATTAGATT AAAGCTTCCA TTTTAAAATT GTAATTGTTT GGGCTGTCAG
CTATTTGCCA TTATTCACAA GTGATAATTG TGACCCTACA ACGAAGAGGC TAACAGTAGG TTTTAGAATT TCAGTAATGT
TATATCTCAA AAGCCAACTA TTACATTTGC AGGGAAGGAT ATTAGTGATT TTCTACTGCT GTTTCGTCAG AAGGACAAGA
ACTGAAGAAT TCAGTTAGCA ACAGTATGGT GTTGCCTTCA TCAAATACCA GGGCCACTTC TTCCATGGCT TACCCTGTTT
CCCTGAGCAG CCTCCACCAC CACCCCAACA ACCACCATGC TTTTTTTCTT CCCTCGAAAA CAAACCATGA TAATACTCAT
AAACCTATTG AATCCTCTAG AATTTCTAGA CGGTCTCTCA TCTTCCTCCC TGTCCTCCCT TCTCTTCTAT ACGCTTCATC
ATCCCCTGCC TTAGATGACG CAAACATTCC ATCCACCTCT GCCATTGATA CCACCATCAC AGATCGGATC TTCATGGACT
TCAGTGTCTG CCCTAGCTAC TTTCGCTCTG ACCGCACTTT AGGAGCTGAG CTTGCTACAT GTCCTGATTC TGAACCTCTT
GGTCGTGTAA TTTTTGGTTT GTATGGTCGA CTCCTCCCCC TCACTACTGC CAACTTCAAA GCTGCTTGCA CTTCTGCTGC
ATACCGGGGA ACACTTGTCC ACAAGCTCCT TCAGGGCCAG TTCTTCGTTG CTGGCCGCCA AGGTCCTCGG CGTGACAGGG
GCGAGGTCCA ACCTCCCACC GGACTTGTGA GGAATGCTGA GACTATTGAC CCTAAAGCAT TTGAACTAAA GCATGCAAGG
CCTGGCACCC TCTCATTGTG CCTTGGACAG AACGATGACG ATGATGACAT CAAGCTCAAT CCTAATTATC ACAATGTTGA
ATTCTTGGTT ACCACTGGAC CAGGGCCCTG CCCAGAGCTT GATGGACAGA ACATTGTCTT TGGAACTGTA TTGGAAGGTT
AGTTGCTTTC ATTTTCTGAA CTTTTACTAA ATGGTTCTTG CACACTTTGT GTTAAATTCT GTCTTGCAAG AATTTCAATG
TCTTTCCCTC GAACAAGTTG GGATTTGACC TGTGCGTAAT CTACTAATGC AAGGTTGGCA TGATTAAATT CATGCATAAA
TCTATTTTCT TTGGTTCAAA CAGAGAAAAA TAAAATGTAT TTCAAACCGT TTCATTTTTT GTCAAGTATA ATTATATGAC
ATCTTCCATT CTCCTTTTGG TATAGTTATA TACACTTGCT AAGGTAAACA TGTTTTCATT GAAGTAATCA ACATTAGTAC
ATAACAGAGA AGAAAAAAAA TGCAAATTTT GCAGCTTTGC ATGAGTATTA ACAAAATAAC AAACAGTTGT GTCCGTATTC
TGGCTAGGAC TTCATCCATG CAGAACATAA AGTTAGATGT TTTATTATTA CCAATTTCTG CAAGTAATAT AAGCTTGTAA
AGAAATTGTC ATTTTATTTC TTCCTTTTTG TTGTCTCAAC ACCAAGGATG GTTATCACAC TAAGATTAAT TCTTTTTTTT
TTCTTCTCTG CACTTCACCA CAGTATAACT CATCATCAAT TCCTGCCATG GTTTGTTCTA ACAATGTGCC ACATTGTCAA
TAAACAACAC CAGAGAGTGT ATCATCCTCA TATAGTCAAA TTTGGTGCAT ACTTCATTGT TTTTCCCTGT TCTGATTTAT
TAGATCTCTG GTGGTTATCA GAAGTAGATT GAACTAAACC AAGCAACTCA TCAATGAGAT TTATACTGCC ACTGAACATG
TCACCCCAAA AGAGAATCTA CTTCTAGCTA ATTTAAGACT GACATGTCTG CTTTGACAGT TTGATTTGTA ATTTAATAAA
CTTTACAACA ACAACCAGGG CAGTAGTTAA CTACAAAGCA GTTCATATTT AAGTTTTATG CATCAAGAAC TTAAAAGCAC
GGCCCTTCTA TCCCCAAAAA AGCACATGCC CACGTTCTGC ATCTGCATGC CCATGCGGCA TGCTCTCATG CACATGCATG
GGCAGACGCA ACAAATGCAT GCGCACATAC AACTATATAA CTTATATTCA CATGACACTT GAGGCACACT AATGCTTGTC
ATTAGGACCC ATTGCCACTT GAAGTGTAAT AGTGTTACTC ATTTGAACTG AACTAGCTAC TTAGTCTCAG TTTCAGTATT
TGATTATTAC CAACAGTTTT TTCTTAAGCA TCCATTTTTC TTCTTCTATA AGCAACTTTG ATTGTCAAGT TCTGCATTCA
CATGCACACA TAGGCGACTA AAACAGACTT TCAAGCACTG AGTTAAACAA GTGTATTAAT TGGATATATT CCAGTGGAAT
TGACATGAAG CTTCAATTTT GTACGAGTTG CTTTCTGTTG TCTTAATGGA AACTAGTATT GCCACTGTAT GATTAATGAT
GATATTGTTG ATTCAGATTA ACAGAAAGCG GCTAATTCGA AAGATTTTAC ATGATAATTT GTACATATGT AATTTGTAAC
TATTATATAG TTTTAATATA TCGCAGTAGC AGTCTCTCCT GCTGTTTTCA TCGTCAAAAA AAAAAAAAAC TGTTTTCTCC
GCAATTCCTT TTTTTAACTA TTTGGTCTTG CAACTTGTGT TTTTATCAGA TTATTTCTGC ACGATTGGCA GTCCATTCAA
TTCAAGGTTG AAATTTTTTA CAGAAGAGCT AATGTGTTAA TAGTATAAAT CAAGTGGATA CTTCTAGCAT AATAGAGAAC
TGTCTTGATT TCCTTGCCCA AAAAAAAAGA GGACCGAGTG GTTTTTAATC TATTTCTGAT TAAGTCAGTG TATGAAAAAA
AAAATCAGCT ACCACTTATC TTTCTTTCAT GAAGAACCCC CTTTTTCTTA ACAAAGCATA CTCTCCGTAT AGCCATGGAA
GTATATATTA ATTACATAAA ACAGAAAGAC TGTATGACAT TTTTTTTGTG AATATGTAAA GGTAGCCATT ACTATCTTTT
TATTAGCCTC ATTTTTCTTG AGCAAATGAG AAAAAAGTAT AAAATACAAA AAGTCAAATC ATGTGGTGAA CGATTATGTT
CTCAATAGTG CTTTCATTAA AGTGTTTGGG ACCATGTATT GTTGGGTAGC ATTGCCATAC TCCACTGATA TGTGGTTGAG
AATGGTGATG TGGATGCACA TTTAAGGCCG ATAGTTTGAT GCTGCTTCTT TTTTTCTCCA AGTGGCAGAT TTATCACATG
TGGATAATAG ATATTAGGTT CATCTGTTTG GAATGCATAT GTACAGTGAA AGATGTACTA TGGCACCGAC ATCTTATGAA
ATAATTTAGA GATCACATTG TCTTATGAAC ATATTGAATA TGGTTAAAAC TTGTGAATAT CAGATTATCA GTTCAGTATA
AATTAATTTA CTTCTGGAGT TTATCTGTAT TGAAATTTAT TCCGTAAATT GTATCTGTTA ACTGTAGTAG TGCTGCAGAA
ACTCTGCCTG AGGCAGTCCA TATCTTTTCT CCTTTTACTA CATTGTAGAC TACCGTAGAC CATATGATCC TGCCATTCTT
AACATGCATG CAATTGAAGC AATTTGGCTA TGATACTTAC TAGATTGCCC AGTAAATATA TGCTAATTTT AGGAAAATAG
TTGTTATGCA TTAACAGTCC CCCGACTAAA TTAGTCTAAT CTTTTCGTAA TGTTTATTTA ATTTATTGTG CAGGAATGAA
TGTTATAACC AGCATTGCAA CTATTCCTAC CTATAAACCA GCTGAAAGGA TCCGCTTCTT CAATGATTTT GCCCAGTTGA
TTGGTGATGA AAGAGCTCAA ACTGCTCGAG CGTTGTGGGA TCGCCCGCTA AAAACTGTTT ATATCAGTGA TTGCGGAGAG
CTAAAAGTGA CCAAACCATC ACTTTCCCCT CCAAGTCTGC CATAAAAAAC CACAGAGGCA ATTTTGTGTA CCTACACTTA
TTCTTCTCCC TCCAATGTCA ACTGTATATA TGCCATCTAG TATTAACTGA CATCTGCTGT GTTTCTGGCC CAAAATGTGT
ACGACGGGTC TCTGATTCAT CGAAGTAAAT ATATTACAGT GCTGTGC

Locus: Os08g0292600

Loading...

Locus: Os08g0292600

Loading...