Os08t0292600-03

Locus

Os08g0292600

Description

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP28

CGSNL Gene Name

CYCLOPHILIN 28

Oryzabase Gene Symbol Synonym(s)

OsCYP28, OsCYP-21, OsCYP28a, OsCYP28b, OsCYP28c, OsCYP28d

Oryzabase Gene Name Synonym(s)

cyclophilin 28, cyclophilin 21

Transcript Evidence

AK069211 (DDBJ, Best hit)

Protein Evidence

B4FFW0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Full-length cDNA

J023011I02 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0292600-03)

RiceXPro (AK069211)

Others

Oryzabase (10067)

KEGG (Os08t0292600-03 (EC:5.2.1.8))

Transcript

1387 bp

>Os08t0292600-03 Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.
gttctcctccgctccttgcgccgccgccaagacgagcggagggccgggcggcgatctcca
tctggcaagcagagcagcggaggggaggaggggatcctgGGAAGGATATTAGTGATTTTC
TACTGCTGTTTCGTCAGAAGGACAAGAACTGAAGAATTCAGTTAGCAACAGTATGGTGTT
GCCTTCATCAAATACCAGGGCCACTTCTTCCATGGCTTACCCTGTTTCCCTGAGCAGCCT
CCACCACCACCCCAACAACCACCATGCTTTTTTTCTTCCCTCGAAAACAAACCATGATAA
TACTCATAAACCTATTGAATCCTCTAGAATTTCTAGACGGTCTCTCATCTTCCTCCCTGT
CCTCCCTTCTCTTCTATACGCTTCATCATCCCCTGCCTTAGATGACGCAAACATTCCATC
CACCTCTGCCATTGATACCACCATCACAGATCGGATCTTCATGGACTTCAGTGTCTGCCC
TAGCTACTTTCGCTCTGACCGCACTTTAGGAGCTGAGCTTGCTACATGTCCTGATTCTGA
ACCTCTTGGTCGTGTAATTTTTGGTTTGTATGGTCGACTCCTCCCCCTCACTACTGCCAA
CTTCAAAGCTGCTTGCACTTCTGCTGCATACCGGGGAACACTTGTCCACAAGCTCCTTCA
GGGCCAGTTCTTCGTTGCTGGCCGCCAAGGTCCTCGGCGTGACAGGGGCGAGGTCCAACC
TCCCACCGGACTTGTGAGGAATGCTGAGACTATTGACCCTAAAGCATTTGAACTAAAGCA
TGCAAGGCCTGGCACCCTCTCATTGTGCCTTGGACAGAACGATGACGATGATGACATCAA
GCTCAATCCTAATTATCACAATGTTGAATTCTTGGTTACCACTGGACCAGGGCCCTGCCC
AGAGCTTGATGGACAGAACATTGTCTTTGGAACTGTATTGGAAGGAATGAATGTTATAAC
CAGCATTGCAACTATTCCTACCTATAAACCAGCTGAAAGGATCCGCTTCTTCAATGATTT
TGCCCAGTTGATTGGTGATGAAAGAGCTCAAACTGCTCGAGCGTTGTGGGATCGCCCGCT
AAAAACTGTTTATATCAGTGATTGCGGAGAGCTAAAAGTGACCAAACCATCACTTTCCCC
TCCAAGTCTGCCATAAAAAACCACAGAGGCAATTTTGTGTACCTACACTTATTCTTCTCC
CTCCAATGTCAACTGTATATATGCCATCTAGTATTAACTGACATCTGCTGTGTTTCTGGC
CCAAAATGTGTACGACGGGTCTCTGATTCATCGAAGTAAATATATTACAGTGCTGTGCAA
AATTCTTGACCTGTCAGCTTTCATCTTGGATAACCGTTGAGACTATGATGCTAATGATTA
GCTTCTC

CDS

984 bp

>Os08t0292600-03 Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.
ATGGTGTTGCCTTCATCAAATACCAGGGCCACTTCTTCCATGGCTTACCCTGTTTCCCTG
AGCAGCCTCCACCACCACCCCAACAACCACCATGCTTTTTTTCTTCCCTCGAAAACAAAC
CATGATAATACTCATAAACCTATTGAATCCTCTAGAATTTCTAGACGGTCTCTCATCTTC
CTCCCTGTCCTCCCTTCTCTTCTATACGCTTCATCATCCCCTGCCTTAGATGACGCAAAC
ATTCCATCCACCTCTGCCATTGATACCACCATCACAGATCGGATCTTCATGGACTTCAGT
GTCTGCCCTAGCTACTTTCGCTCTGACCGCACTTTAGGAGCTGAGCTTGCTACATGTCCT
GATTCTGAACCTCTTGGTCGTGTAATTTTTGGTTTGTATGGTCGACTCCTCCCCCTCACT
ACTGCCAACTTCAAAGCTGCTTGCACTTCTGCTGCATACCGGGGAACACTTGTCCACAAG
CTCCTTCAGGGCCAGTTCTTCGTTGCTGGCCGCCAAGGTCCTCGGCGTGACAGGGGCGAG
GTCCAACCTCCCACCGGACTTGTGAGGAATGCTGAGACTATTGACCCTAAAGCATTTGAA
CTAAAGCATGCAAGGCCTGGCACCCTCTCATTGTGCCTTGGACAGAACGATGACGATGAT
GACATCAAGCTCAATCCTAATTATCACAATGTTGAATTCTTGGTTACCACTGGACCAGGG
CCCTGCCCAGAGCTTGATGGACAGAACATTGTCTTTGGAACTGTATTGGAAGGAATGAAT
GTTATAACCAGCATTGCAACTATTCCTACCTATAAACCAGCTGAAAGGATCCGCTTCTTC
AATGATTTTGCCCAGTTGATTGGTGATGAAAGAGCTCAAACTGCTCGAGCGTTGTGGGAT
CGCCCGCTAAAAACTGTTTATATCAGTGATTGCGGAGAGCTAAAAGTGACCAAACCATCA
CTTTCCCCTCCAAGTCTGCCATAA

Protein

328 aa

>Os08t0292600-03 Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.
MVLPSSNTRATSSMAYPVSLSSLHHHPNNHHAFFLPSKTNHDNTHKPIESSRISRRSLIF
LPVLPSLLYASSSPALDDANIPSTSAIDTTITDRIFMDFSVCPSYFRSDRTLGAELATCP
DSEPLGRVIFGLYGRLLPLTTANFKAACTSAAYRGTLVHKLLQGQFFVAGRQGPRRDRGE
VQPPTGLVRNAETIDPKAFELKHARPGTLSLCLGQNDDDDDIKLNPNYHNVEFLVTTGPG
PCPELDGQNIVFGTVLEGMNVITSIATIPTYKPAERIRFFNDFAQLIGDERAQTARALWD
RPLKTVYISDCGELKVTKPSLSPPSLP*

5'UTR

chr08:11728314..11728412 (+ strand) : 99 bp

chr08:11729103..11729175 (+ strand) : 73 bp

CDS

chr08:11729176..11729947 (+ strand) : 772 bp

chr08:11732664..11732875 (+ strand) : 212 bp

3'UTR

chr08:11732876..11733106 (+ strand) : 231 bp

FASTA

>Os08t0292600-03 class=Sequence position=chr08:11728314..11733106 (+ strand)
gttctcctcc gctccttgcg ccgccgccaa gacgagcgga gggccgggcg gcgatctcca tctggcaagc agagcagcgg
aggggaggag gggatcctgg tgcgtcctct ttctgatcca tctctctctc tctctctctc tctctctccc accccaccgg
gacctggaat ttgcttgcgt tcgtgaattt gatagcctta aacctctctt atttcaagta ataacagttt gtttgtttac
ctaaaagttc gggggttcaa ccgaaccccc atgccccaag ttggatccgc ccctgGTTTG AATTGCTGAA ACATAATTTC
GAGCTAGTTA AACGAAGAGA CAACATGCCT GGAAATGTAA AAAAAAAGTA TGCTGATTTG AATTTGATTG TTGGAACTGC
CCTATAGGAA ACTGGTAAAT TTTAGAACAA AAAACCTTGC TTATAGTAAA ATCGTGAATG GATGATATGC AAAGACATGG
TGAGAAATAT TCACTCGCTC ATACTACAAC TACTTAAGAG GACCATATTT GCTCACTCTG GAATAGCTGC TGACCTGCTG
TGACCATCAT ACACCCCCTC ACCGCAATGC AGGTTCCATT TGAAGTAATC GGAGAATGGT ATGTTGAGAA TTAGATTAAA
GCTTCCATTT TAAAATTGTA ATTGTTTGGG CTGTCAGCTA TTTGCCATTA TTCACAAGTG ATAATTGTGA CCCTACAACG
AAGAGGCTAA CAGTAGGTTT TAGAATTTCA GTAATGTTAT ATCTCAAAAG CCAACTATTA CATTTGCAGG GAAGGATATT
AGTGATTTTC TACTGCTGTT TCGTCAGAAG GACAAGAACT GAAGAATTCA GTTAGCAACA GTATGGTGTT GCCTTCATCA
AATACCAGGG CCACTTCTTC CATGGCTTAC CCTGTTTCCC TGAGCAGCCT CCACCACCAC CCCAACAACC ACCATGCTTT
TTTTCTTCCC TCGAAAACAA ACCATGATAA TACTCATAAA CCTATTGAAT CCTCTAGAAT TTCTAGACGG TCTCTCATCT
TCCTCCCTGT CCTCCCTTCT CTTCTATACG CTTCATCATC CCCTGCCTTA GATGACGCAA ACATTCCATC CACCTCTGCC
ATTGATACCA CCATCACAGA TCGGATCTTC ATGGACTTCA GTGTCTGCCC TAGCTACTTT CGCTCTGACC GCACTTTAGG
AGCTGAGCTT GCTACATGTC CTGATTCTGA ACCTCTTGGT CGTGTAATTT TTGGTTTGTA TGGTCGACTC CTCCCCCTCA
CTACTGCCAA CTTCAAAGCT GCTTGCACTT CTGCTGCATA CCGGGGAACA CTTGTCCACA AGCTCCTTCA GGGCCAGTTC
TTCGTTGCTG GCCGCCAAGG TCCTCGGCGT GACAGGGGCG AGGTCCAACC TCCCACCGGA CTTGTGAGGA ATGCTGAGAC
TATTGACCCT AAAGCATTTG AACTAAAGCA TGCAAGGCCT GGCACCCTCT CATTGTGCCT TGGACAGAAC GATGACGATG
ATGACATCAA GCTCAATCCT AATTATCACA ATGTTGAATT CTTGGTTACC ACTGGACCAG GGCCCTGCCC AGAGCTTGAT
GGACAGAACA TTGTCTTTGG AACTGTATTG GAAGGTTAGT TGCTTTCATT TTCTGAACTT TTACTAAATG GTTCTTGCAC
ACTTTGTGTT AAATTCTGTC TTGCAAGAAT TTCAATGTCT TTCCCTCGAA CAAGTTGGGA TTTGACCTGT GCGTAATCTA
CTAATGCAAG GTTGGCATGA TTAAATTCAT GCATAAATCT ATTTTCTTTG GTTCAAACAG AGAAAAATAA AATGTATTTC
AAACCGTTTC ATTTTTTGTC AAGTATAATT ATATGACATC TTCCATTCTC CTTTTGGTAT AGTTATATAC ACTTGCTAAG
GTAAACATGT TTTCATTGAA GTAATCAACA TTAGTACATA ACAGAGAAGA AAAAAAATGC AAATTTTGCA GCTTTGCATG
AGTATTAACA AAATAACAAA CAGTTGTGTC CGTATTCTGG CTAGGACTTC ATCCATGCAG AACATAAAGT TAGATGTTTT
ATTATTACCA ATTTCTGCAA GTAATATAAG CTTGTAAAGA AATTGTCATT TTATTTCTTC CTTTTTGTTG TCTCAACACC
AAGGATGGTT ATCACACTAA GATTAATTCT TTTTTTTTTC TTCTCTGCAC TTCACCACAG TATAACTCAT CATCAATTCC
TGCCATGGTT TGTTCTAACA ATGTGCCACA TTGTCAATAA ACAACACCAG AGAGTGTATC ATCCTCATAT AGTCAAATTT
GGTGCATACT TCATTGTTTT TCCCTGTTCT GATTTATTAG ATCTCTGGTG GTTATCAGAA GTAGATTGAA CTAAACCAAG
CAACTCATCA ATGAGATTTA TACTGCCACT GAACATGTCA CCCCAAAAGA GAATCTACTT CTAGCTAATT TAAGACTGAC
ATGTCTGCTT TGACAGTTTG ATTTGTAATT TAATAAACTT TACAACAACA ACCAGGGCAG TAGTTAACTA CAAAGCAGTT
CATATTTAAG TTTTATGCAT CAAGAACTTA AAAGCACGGC CCTTCTATCC CCAAAAAAGC ACATGCCCAC GTTCTGCATC
TGCATGCCCA TGCGGCATGC TCTCATGCAC ATGCATGGGC AGACGCAACA AATGCATGCG CACATACAAC TATATAACTT
ATATTCACAT GACACTTGAG GCACACTAAT GCTTGTCATT AGGACCCATT GCCACTTGAA GTGTAATAGT GTTACTCATT
TGAACTGAAC TAGCTACTTA GTCTCAGTTT CAGTATTTGA TTATTACCAA CAGTTTTTTC TTAAGCATCC ATTTTTCTTC
TTCTATAAGC AACTTTGATT GTCAAGTTCT GCATTCACAT GCACACATAG GCGACTAAAA CAGACTTTCA AGCACTGAGT
TAAACAAGTG TATTAATTGG ATATATTCCA GTGGAATTGA CATGAAGCTT CAATTTTGTA CGAGTTGCTT TCTGTTGTCT
TAATGGAAAC TAGTATTGCC ACTGTATGAT TAATGATGAT ATTGTTGATT CAGATTAACA GAAAGCGGCT AATTCGAAAG
ATTTTACATG ATAATTTGTA CATATGTAAT TTGTAACTAT TATATAGTTT TAATATATCG CAGTAGCAGT CTCTCCTGCT
GTTTTCATCG TCAAAAAAAA AAAAAACTGT TTTCTCCGCA ATTCCTTTTT TTAACTATTT GGTCTTGCAA CTTGTGTTTT
TATCAGATTA TTTCTGCACG ATTGGCAGTC CATTCAATTC AAGGTTGAAA TTTTTTACAG AAGAGCTAAT GTGTTAATAG
TATAAATCAA GTGGATACTT CTAGCATAAT AGAGAACTGT CTTGATTTCC TTGCCCAAAA AAAAAGAGGA CCGAGTGGTT
TTTAATCTAT TTCTGATTAA GTCAGTGTAT GAAAAAAAAA ATCAGCTACC ACTTATCTTT CTTTCATGAA GAACCCCCTT
TTTCTTAACA AAGCATACTC TCCGTATAGC CATGGAAGTA TATATTAATT ACATAAAACA GAAAGACTGT ATGACATTTT
TTTTGTGAAT ATGTAAAGGT AGCCATTACT ATCTTTTTAT TAGCCTCATT TTTCTTGAGC AAATGAGAAA AAAGTATAAA
ATACAAAAAG TCAAATCATG TGGTGAACGA TTATGTTCTC AATAGTGCTT TCATTAAAGT GTTTGGGACC ATGTATTGTT
GGGTAGCATT GCCATACTCC ACTGATATGT GGTTGAGAAT GGTGATGTGG ATGCACATTT AAGGCCGATA GTTTGATGCT
GCTTCTTTTT TTCTCCAAGT GGCAGATTTA TCACATGTGG ATAATAGATA TTAGGTTCAT CTGTTTGGAA TGCATATGTA
CAGTGAAAGA TGTACTATGG CACCGACATC TTATGAAATA ATTTAGAGAT CACATTGTCT TATGAACATA TTGAATATGG
TTAAAACTTG TGAATATCAG ATTATCAGTT CAGTATAAAT TAATTTACTT CTGGAGTTTA TCTGTATTGA AATTTATTCC
GTAAATTGTA TCTGTTAACT GTAGTAGTGC TGCAGAAACT CTGCCTGAGG CAGTCCATAT CTTTTCTCCT TTTACTACAT
TGTAGACTAC CGTAGACCAT ATGATCCTGC CATTCTTAAC ATGCATGCAA TTGAAGCAAT TTGGCTATGA TACTTACTAG
ATTGCCCAGT AAATATATGC TAATTTTAGG AAAATAGTTG TTATGCATTA ACAGTCCCCC GACTAAATTA GTCTAATCTT
TTCGTAATGT TTATTTAATT TATTGTGCAG GAATGAATGT TATAACCAGC ATTGCAACTA TTCCTACCTA TAAACCAGCT
GAAAGGATCC GCTTCTTCAA TGATTTTGCC CAGTTGATTG GTGATGAAAG AGCTCAAACT GCTCGAGCGT TGTGGGATCG
CCCGCTAAAA ACTGTTTATA TCAGTGATTG CGGAGAGCTA AAAGTGACCA AACCATCACT TTCCCCTCCA AGTCTGCCAT
AAAAAACCAC AGAGGCAATT TTGTGTACCT ACACTTATTC TTCTCCCTCC AATGTCAACT GTATATATGC CATCTAGTAT
TAACTGACAT CTGCTGTGTT TCTGGCCCAA AATGTGTACG ACGGGTCTCT GATTCATCGA AGTAAATATA TTACAGTGCT
GTGCAAAATT CTTGACCTGT CAGCTTTCAT CTTGGATAAC CGTTGAGACT ATGATGCTAA TGATTAGCTT CTC

Locus: Os08g0292600

Loading...

Locus: Os08g0292600

Loading...