Os08t0320200-01

Locus

Os08g0320200

Description

Similar to oligopeptide transporter OPT family.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsOPT5

Oryzabase Gene Name Synonym(s)

Oligopeptide transporter 5

Transcript Evidence

AK072608 (DDBJ, Best hit)

Protein Evidence

XP_002329927.1 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Functional domain (InterPro)

Oligopeptide transporter OPT superfamily (IPR004813)

Full-length cDNA

J023134K04 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0320200-01)

Others

Oryzabase (12498)

Transcript

2598 bp

>Os08t0320200-01 Similar to oligopeptide transporter OPT family.
AGCAAGGCGAGCAGAATTTCAGAAGCTGACGAGGAAAACAGAACAAAACAGGGGAGAAAC
AAGCCTACAGATGATGGCTCGGTCTATCCCGCCGGAGTCCGGTGACGAGAACGTCTCGGC
TTCTGCCGATGGCGGCCTATTTTAGGGACAGAAGATGACAAAAGAACATCAAGGAAGAGG
GCGTACGTGTAGAGAAAGACGGTGAAATATTTTGCCAGCCAGCCGGCCGGCCGGAGTCCG
ACGATCGAGCACATTCCGATGGACACTGCAGGCGGTACAACAAACCACGCCTAAAACCTC
CTTTACTTAGGAGGGCATGGAGGAGGAGGTGAACGACCACCCGATCGAGGAGGTCCGGAA
CACGGTGCCGGTGACCGACGACCCGTCGGAGCCGTGCCTGACGTTCCGGGTGTGGGTGCT
GGGGCTCTCGTCGTGCGTGTTCCTCGCCTTCGTCAACGAGTTCTTCATGTACCGGACCAC
GCAGCTGAGCATCGGCACGGTGGTGGTGCAAATCATCACGCTGCCCATCGGCCGCCTCAT
GGCGTCGACGCTGCCGGCGAGGCGCCTCCGCGTCGGCGGCTGGTCCTTCTCCCTCAACCC
GGGGCCCTTCAGCCTCAAGGAGCATTGCCTCATCATCATCTTCGCCGGCGCCGGCGCCAG
CGGCGTCTATGCCATGAACATCATCGCCATCGTCAAGGTGTTCTACAAGCGCCAGATCAG
CCCCTACGCCGCCATGCTGCTCGCCCAGACCACCCAGTTGCTTGGGTATGGATGGGCCGG
ATTGTTCAGGAAGTACCTGGTTGACTCAGCCTACATGTGGTGGCCGTCAAACCTCGTCCA
AGTCACCCTCTTCAGGGCGATGCACGAGGAGGAGAAGAGGAACAAGGGGCAGCTGACGCG
GCTGCAGTTCTTCATCATGGTGATGACGTGCAGCTTCGCCTACTATATCGTACCCAGCTA
CCTGTTCCCGGCGATCAGCACCATCTCGGTGCTGTGCTGGCTGTACAGGGACTCGGTGAC
GGCGCAGCAGATCGGCTCCGGCGCCTCGGGCCTCGGCGTCGGCTCCTTCGGCCTCGACTG
GAACACCGTGGTGGGCTTCCTCGGCAACCCGCTGGCGTCGCCGGCGTTCGCCATCTTCAA
CGTCATGGCCGGCTTCGCGCTCAGCACCTACGTCGCCGTGCCGATCCTCTACTGGACCGA
CACCTACAACGCCAAGCGCTTCCCGCTCGTGTCGTCGCACGTCTTCAACGCCGCCGGCGG
CCGCTACGACACCGCCCGCATCCTCGACCCGGCCACCTTCACGCTCAACCTCAGGGAGTA
CGACGCCTACGGCCGCATCAACCTCAGCATCCTCTTCGCCATCAACTACGGCATCGGCTT
CGCGGGCCTCATGTCCACGCTCTCCCACGTCGCGCTCTACCACGGGACATTTGGGGCTTG
TGGCGGAAGGCAACGGCGGAGCAGGCGAACGGCGGCGGCAAGGAGCGCCAAGACGTGCAC
ACGAGAATCATGAAGAGGAACTACAAGGCCGTGCCACAGTGGTGGTTTCACTTGATGCTG
GCCATCGTGATGGCATTGTCGCTGTACACCTGTGAGGGGTTTGGCCGGCAGCTTCAGCTG
CCATACTGGGGTCTCCTCCTTGCCTGTGCCATCGCCTTCACCTTCACGTTGCCCATCGGC
GTCATCTCTGCCACGACCAACATGCAACCAGGGTTAAACATCATCACAGAGCTCATCATC
GGGTACCTGTACCCGGGGAAGCCATTGGCGAATGTGGTGTTCAAGACCTACGGCTACATA
AGCATGACTCAGGCGCTGACGTTTGTGTCGGATTTCAAGCTGGGGCACTACATGAAGATA
CCGCCCAGGTCCATGTTCATGGTGCAGCTGGCAGGGACGGTGGTGGCGTCGACGGTGCAC
TTCGCGACGGCGTGGTGGCTGCTGACGACGGTGAGGAACATCTGCGACGTGGACAGCCTG
CCGCTGGGGAGCCCGTGGACGTGCCCCGGCGAGGACGTCTTCTACAACGCCTCCATCATC
TGGGGCGTCGTCGGACCGCTCCGGATGTTTGGCCGTCTCGGCAACTACTGGCAGATGAAC
TACTTCTTCCTCGTCGGCGTCCTCGCGCCGGTGCCCGTCTGGCTGCTGTCGCGCCGGTAC
CCGCGCAGCGCGTTGCTCCGGGACATCAACCTGCCGCTCGTCCTCGCCGGCGCCAGCGGG
CTGCTCCCGGCGAGGTCCGTCAACTTCGTCATGTGGGGGCTCGTCGGGTTCGTGTTCAAC
CACGTCGTGTACCGCCGGTGCAGGGCGTGGTGGATGCGGCATAACTACGTGCTCGCCGCG
GGGCTCGACGCCGGCGTCGCCTTCATGGGCGTGCTCACCTTCGTCTCGCTAGGATACTTC
GACATATACGGGGTGCAGTGGTGGGGTGGCGCCGCCGATGATCACTGCCCCTTGGCGTCG
TGCCCCACAGCACCTGGGGTGTTTGCCAGGGGATGCCCGCCTGTACCTTCTTGATTGATC
AGGACACCGCATCTACATGTATATACTCCATATGACAGATGGTTACTCAAATGTATATAT
TATATCCTCTTGTCTTCC

CDS

1197 bp

>Os08t0320200-01 Similar to oligopeptide transporter OPT family.
ATGGAGGAGGAGGTGAACGACCACCCGATCGAGGAGGTCCGGAACACGGTGCCGGTGACC
GACGACCCGTCGGAGCCGTGCCTGACGTTCCGGGTGTGGGTGCTGGGGCTCTCGTCGTGC
GTGTTCCTCGCCTTCGTCAACGAGTTCTTCATGTACCGGACCACGCAGCTGAGCATCGGC
ACGGTGGTGGTGCAAATCATCACGCTGCCCATCGGCCGCCTCATGGCGTCGACGCTGCCG
GCGAGGCGCCTCCGCGTCGGCGGCTGGTCCTTCTCCCTCAACCCGGGGCCCTTCAGCCTC
AAGGAGCATTGCCTCATCATCATCTTCGCCGGCGCCGGCGCCAGCGGCGTCTATGCCATG
AACATCATCGCCATCGTCAAGGTGTTCTACAAGCGCCAGATCAGCCCCTACGCCGCCATG
CTGCTCGCCCAGACCACCCAGTTGCTTGGGTATGGATGGGCCGGATTGTTCAGGAAGTAC
CTGGTTGACTCAGCCTACATGTGGTGGCCGTCAAACCTCGTCCAAGTCACCCTCTTCAGG
GCGATGCACGAGGAGGAGAAGAGGAACAAGGGGCAGCTGACGCGGCTGCAGTTCTTCATC
ATGGTGATGACGTGCAGCTTCGCCTACTATATCGTACCCAGCTACCTGTTCCCGGCGATC
AGCACCATCTCGGTGCTGTGCTGGCTGTACAGGGACTCGGTGACGGCGCAGCAGATCGGC
TCCGGCGCCTCGGGCCTCGGCGTCGGCTCCTTCGGCCTCGACTGGAACACCGTGGTGGGC
TTCCTCGGCAACCCGCTGGCGTCGCCGGCGTTCGCCATCTTCAACGTCATGGCCGGCTTC
GCGCTCAGCACCTACGTCGCCGTGCCGATCCTCTACTGGACCGACACCTACAACGCCAAG
CGCTTCCCGCTCGTGTCGTCGCACGTCTTCAACGCCGCCGGCGGCCGCTACGACACCGCC
CGCATCCTCGACCCGGCCACCTTCACGCTCAACCTCAGGGAGTACGACGCCTACGGCCGC
ATCAACCTCAGCATCCTCTTCGCCATCAACTACGGCATCGGCTTCGCGGGCCTCATGTCC
ACGCTCTCCCACGTCGCGCTCTACCACGGGACATTTGGGGCTTGTGGCGGAAGGCAACGG
CGGAGCAGGCGAACGGCGGCGGCAAGGAGCGCCAAGACGTGCACACGAGAATCATGA

Protein

399 aa

>Os08t0320200-01 Similar to oligopeptide transporter OPT family.
MEEEVNDHPIEEVRNTVPVTDDPSEPCLTFRVWVLGLSSCVFLAFVNEFFMYRTTQLSIG
TVVVQIITLPIGRLMASTLPARRLRVGGWSFSLNPGPFSLKEHCLIIIFAGAGASGVYAM
NIIAIVKVFYKRQISPYAAMLLAQTTQLLGYGWAGLFRKYLVDSAYMWWPSNLVQVTLFR
AMHEEEKRNKGQLTRLQFFIMVMTCSFAYYIVPSYLFPAISTISVLCWLYRDSVTAQQIG
SGASGLGVGSFGLDWNTVVGFLGNPLASPAFAIFNVMAGFALSTYVAVPILYWTDTYNAK
RFPLVSSHVFNAAGGRYDTARILDPATFTLNLREYDAYGRINLSILFAINYGIGFAGLMS
TLSHVALYHGTFGACGGRQRRSRRTAAARSAKTCTRES*

5'UTR

chr08:13941984..13942114 (- strand) : 131 bp

chr08:13941514..13941690 (- strand) : 177 bp

chr08:13940361..13940368 (- strand) : 8 bp

CDS

chr08:13939920..13940360 (- strand) : 441 bp

chr08:13939724..13939821 (- strand) : 98 bp

chr08:13938997..13939566 (- strand) : 570 bp

chr08:13938781..13938868 (- strand) : 88 bp

3'UTR

chr08:13938590..13938780 (- strand) : 191 bp

chr08:13937594..13938487 (- strand) : 894 bp

FASTA

>Os08t0320200-01 class=Sequence position=chr08:13937594..13942114 (- strand)
AGCAAGGCGA GCAGAATTTC AGAAGCTGAC GAGGAAAACA GAACAAAACA GGGGAGAAAC AAGCCTACAG ATGATGGCTC
GGTCTATCCC GCCGGAGTCC GGTGACGAGA ACGTCTCGGC TTCTGCCGAT GGTGTGTATG CCTCCTTGTT CATTCTCTGC
ATGAATTGCC TTTCCTACAC TGGGAATGCA AATGAAATTC TCTCGTGGTA GAAGATCGAA ATTAAGCTAC TAGCTAGTTT
CTCTTGGAGA ATGAAATCAA CAACAGTTTT CTTCCACTTC CCATTTGTTC GTGCAAAATT GCTGCTAAAA TATTTAACGA
TTTTACTCAT GTTTCTTTTT TTTTCCCCAA TGGAATCTGA ACGGCTCAGT GTTGCTTTGC TAAAAACATG AGGGTTTGAG
AACTTCTCTC GCAAAGACAT GCAGGCGGCC TATTTTAGGG ACAGAAGATG ACAAAAGAAC ATCAAGGAAG AGGGCGTACG
TGTAGAGAAA GACGGTGAAA TATTTTGCCA GCCAGCCGGC CGGCCGGAGT CCGACGATCG AGCACATTCC GATGGACACT
GCAGGCGGTA CAACAAACCA CGCCTAAAAC CTCCTTTACT TGTAAGTCAT CGTCGCAAAG TTCTACCACA AACAAGTGAA
ACGCATTGAT CGTCAATTTC GTAAAAACAC TTCAAATGCA TAGATCATAA GCTTTCAAAT CTCGGTTGCA Tatcgtttgc
tggttagttt gttagccata gtcaagattt gaattttgaa actttacttg ggagttcttt ttcatcgtaa tctattttta
gcattagctt ttaaactgca aacaaataga tataaaaagt tgtgattAGT TCATTTTGGA ATTTGGGATT ATTTCATTCA
ATTTTGGGTC ATTAGAggaa acacttttaa tcatttagat ggacatccac ccatttgttg cctgtcaaat taaatgatta
tgattttttt ttaaaaaaat ggataagata tattaataCT TCCTCTATTT CACAATGATA AGATATATTA GGGTGCCATC
ATTTGGCATa ttggtggaat aagctaaacg gtatatttgc aaatgaaaag taatttgtga ataaaatttt tatatatgtg
ttattagcga tctaaaagca aaggctgaaa aataaccttc aatgaaaaaa ccctaaaatc agcttcaaat ttaatattga
aaattcaaat tttggctgat aagcatatga atatgccaaa cgatggagac cTAATACGTT Ccgttccaca atgaatctag
acatatagca ttgcctacat tcatatagat ataaagaatc tagacacata tttgtctaga ttcattaGAG TATctatatg
aatgtgaaca gtgctagaaa agtcttacaa tatgaaatag ggggagtaca taatatgtca cttcataaac atacaagttt
aaatttgact tctatgagtt ctaacaaaaa cataaaaaat taactctaat tagtatacgt atatactcac agttaaattt
gtttttctta caactcgtaa aagttaaatt tgaacttgtt tgtttaagtg aatattcata ttaatctatc ttatcttgtc
aattgttttg atttattatt ttgtaattat ctagttgaca tgtaataaat atatgaacat atccaaccga atgattaaaa
GCCCTCTCCG GGTTATCAGC CATAATCACT ATCAGAGTTT TGTGTGTGTG TGTGTGCGCA CTGCAGAGGA GGGCATGGAG
GAGGAGGTGA ACGACCACCC GATCGAGGAG GTCCGGAACA CGGTGCCGGT GACCGACGAC CCGTCGGAGC CGTGCCTGAC
GTTCCGGGTG TGGGTGCTGG GGCTCTCGTC GTGCGTGTTC CTCGCCTTCG TCAACGAGTT CTTCATGTAC CGGACCACGC
AGCTGAGCAT CGGCACGGTG GTGGTGCAAA TCATCACGCT GCCCATCGGC CGCCTCATGG CGTCGACGCT GCCGGCGAGG
CGCCTCCGCG TCGGCGGCTG GTCCTTCTCC CTCAACCCGG GGCCCTTCAG CCTCAAGGAG CATTGCCTCA TCATCATCTT
CGCCGGCGCC GGCGCCAGCG GCGTCTATGC CATGAACATC ATCGCCATCG TCAAGGTGTT CTACAAGCGC CAGATCAGCC
CCTACGCCGC CATGCTGCTC GCCCAGACCA CCCAGGTTGC CACTCATGCA TTGGTTGATT AGTAACAAAT CGAAGACCTG
ATCAAACACA CATTGATTAA TCCAAAAATG GCCTTTTATT TGATTTCATA CAGTTGCTTG GGTATGGATG GGCCGGATTG
TTCAGGAAGT ACCTGGTTGA CTCAGCCTAC ATGTGGTGGC CGTCAAACCT CGTCCAAGTC ACCCTCTTCA GGTAATGGTA
CTAATTACCA GCAGTTATTT TGTCGAAATA TTTGTTTCTG AAAAATATAT GATGCAAATG GGGAATGGGC AAACACAAAC
TTTATTTTGA GCATTTTTTT TTTTTGCGGG GAAACTTATA AGCAAAATTT GGAATGTTTG TCACGCAGGG CGATGCACGA
GGAGGAGAAG AGGAACAAGG GGCAGCTGAC GCGGCTGCAG TTCTTCATCA TGGTGATGAC GTGCAGCTTC GCCTACTATA
TCGTACCCAG CTACCTGTTC CCGGCGATCA GCACCATCTC GGTGCTGTGC TGGCTGTACA GGGACTCGGT GACGGCGCAG
CAGATCGGCT CCGGCGCCTC GGGCCTCGGC GTCGGCTCCT TCGGCCTCGA CTGGAACACC GTGGTGGGCT TCCTCGGCAA
CCCGCTGGCG TCGCCGGCGT TCGCCATCTT CAACGTCATG GCCGGCTTCG CGCTCAGCAC CTACGTCGCC GTGCCGATCC
TCTACTGGAC CGACACCTAC AACGCCAAGC GCTTCCCGCT CGTGTCGTCG CACGTCTTCA ACGCCGCCGG CGGCCGCTAC
GACACCGCCC GCATCCTCGA CCCGGCCACC TTCACGCTCA ACCTCAGGGA GTACGACGCC TACGGCCGCA TCAACCTCAG
CATCCTCTTC GCCATCAACT ACGGCATCGG CTTCGCGGGC CTCATGTCCA CGCTCTCCCA CGTCGCGCTC TACCACGGCA
AGCAAGTTTT CCCGCACAAG CTCTTGCTAA CTTAGTACTC CCGTCAGTCA TAAATATTTG ATATGTTTAT GACAAGATTC
AGCTAACCAG CTTGCAAAAC TTTTGACTTC AATTTGTTCG AGCAGGGACA TTTGGGGCTT GTGGCGGAAG GCAACGGCGG
AGCAGGCGAA CGGCGGCGGC AAGGAGCGCC AAGACGTGCA CACGAGAATC ATGAAGAGGA ACTACAAGGC CGTGCCACAG
TGGTGGTTTC ACTTGATGCT GGCCATCGTG ATGGCATTGT CGCTGTACAC CTGTGAGGGG TTTGGCCGGC AGCTTCAGCT
GCCATACTGG GGTCTCCTCC TTGCCTGTGC CATCGCCTTC ACCTTCACGT TGCCCATCGG CGTCATCTCT GCCACGACCA
ACATGGTCAG CACAAGTAGA ATTACTTTCT CTTTCAGCCT TGAATTAACG TTAACTAAGC TAGTATAGTA GTAAATTGCA
TTATTGTTGG TTGGTTGTTT CTTTCAGCAA CCAGGGTTAA ACATCATCAC AGAGCTCATC ATCGGGTACC TGTACCCGGG
GAAGCCATTG GCGAATGTGG TGTTCAAGAC CTACGGCTAC ATAAGCATGA CTCAGGCGCT GACGTTTGTG TCGGATTTCA
AGCTGGGGCA CTACATGAAG ATACCGCCCA GGTCCATGTT CATGGTGCAG CTGGCAGGGA CGGTGGTGGC GTCGACGGTG
CACTTCGCGA CGGCGTGGTG GCTGCTGACG ACGGTGAGGA ACATCTGCGA CGTGGACAGC CTGCCGCTGG GGAGCCCGTG
GACGTGCCCC GGCGAGGACG TCTTCTACAA CGCCTCCATC ATCTGGGGCG TCGTCGGACC GCTCCGGATG TTTGGCCGTC
TCGGCAACTA CTGGCAGATG AACTACTTCT TCCTCGTCGG CGTCCTCGCG CCGGTGCCCG TCTGGCTGCT GTCGCGCCGG
TACCCGCGCA GCGCGTTGCT CCGGGACATC AACCTGCCGC TCGTCCTCGC CGGCGCCAGC GGGCTGCTCC CGGCGAGGTC
CGTCAACTTC GTCATGTGGG GGCTCGTCGG GTTCGTGTTC AACCACGTCG TGTACCGCCG GTGCAGGGCG TGGTGGATGC
GGCATAACTA CGTGCTCGCC GCGGGGCTCG ACGCCGGCGT CGCCTTCATG GGCGTGCTCA CCTTCGTCTC GCTAGGATAC
TTCGACATAT ACGGGGTGCA GTGGTGGGGT GGCGCCGCCG ATGATCACTG CCCCTTGGCG TCGTGCCCCA CAGCACCTGG
GGTGTTTGCC AGGGGATGCC CGCCTGTACC TTCTTGATTG ATCAGGACAC CGCATCTACA TGTATATACT CCATATGACA
GATGGTTACT CAAATGTATA TATTATATCC TCTTGTCTTC C

Locus: Os08g0320200

Loading...

Locus: Os08g0320200

Loading...