Os08t0320200-02

Locus

Os08g0320200

Description

Oligopeptide transporter OPT superfamily domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsOPT5

Oryzabase Gene Name Synonym(s)

Oligopeptide transporter 5

Transcript Evidence

AK121257 (DDBJ, Best hit)

Protein Evidence

XP_002329927.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Functional domain (InterPro)

Tetrapeptide transporter, OPT1/isp4 (IPR004648)

Oligopeptide transporter OPT superfamily (IPR004813)

Full-length cDNA

J023102I03 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0320200-02)

RiceXPro (AK121257)

Others

Oryzabase (12498)

KEGG (Os08t0320200-02)

Transcript

2878 bp

>Os08t0320200-02 Oligopeptide transporter OPT superfamily domain containing protein.
AGGGGAGAAACAAGCCTACAGATGATGGCTCGGTCTATCCCGCCGGAGTCCGGTGACGAG
AACGTCTCGGCTTCTGCCGATGGTGTGTATGCCTCCTTGTTCATTCTCTGCATGAATTGC
CTTTCCTACACTGGGAATGCAAATGAAATTCTCTCGTGGTAGAAGATCGAAATTAAGCTA
CTAGCTAGTTTCTCTTGGAGAATGAAATCAACAACAGTTTTCTTCCACTTCCCATTTGTT
CGTGCAAAATTGCTGCTAAAATATTTAACGATTTTACTCATGTTTCTTTTTTTTTCCCCA
ATGGAATCTGAACGGCTCAGTGTTGCTTTGCTAAAAACATGAGGGTTTGAGAACTTCTCT
CGCAAAGACATGCAGGCGGCCTATTTTAGGGACAGAAGATGACAAAAGAACATCAAGGAA
GAGGGCGTACGTGTAGAGAAAGACGGTGAAATATTTTGCCAGCCAGCCGGCCGGCCGGAG
TCCGACGATCGAGCACATTCCGATGGACACTGCAGGCGGTACAACAAACCACGCCTAAAA
CCTCCTTTACTTAGTTTTGTGTGTGTGTGTGTGCGCACTGCAGAGGAGGGCATGGAGGAG
GAGGTGAACGACCACCCGATCGAGGAGGTCCGGAACACGGTGCCGGTGACCGACGACCCG
TCGGAGCCGTGCCTGACGTTCCGGGTGTGGGTGCTGGGGCTCTCGTCGTGCGTGTTCCTC
GCCTTCGTCAACGAGTTCTTCATGTACCGGACCACGCAGCTGAGCATCGGCACGGTGGTG
GTGCAAATCATCACGCTGCCCATCGGCCGCCTCATGGCGTCGACGCTGCCGGCGAGGCGC
CTCCGCGTCGGCGGCTGGTCCTTCTCCCTCAACCCGGGGCCCTTCAGCCTCAAGGAGCAT
TGCCTCATCATCATCTTCGCCGGCGCCGGCGCCAGCGGCGTCTATGCCATGAACATCATC
GCCATCGTCAAGGTGTTCTACAAGCGCCAGATCAGCCCCTACGCCGCCATGCTGCTCGCC
CAGACCACCCAGTTGCTTGGGTATGGATGGGCCGGATTGTTCAGGAAGTACCTGGTTGAC
TCAGCCTACATGTGGTGGCCGTCAAACCTCGTCCAAGTCACCCTCTTCAGGGCGATGCAC
GAGGAGGAGAAGAGGAACAAGGGGCAGCTGACGCGGCTGCAGTTCTTCATCATGGTGATG
ACGTGCAGCTTCGCCTACTATATCGTACCCAGCTACCTGTTCCCGGCGATCAGCACCATC
TCGGTGCTGTGCTGGCTGTACAGGGACTCGGTGACGGCGCAGCAGATCGGCTCCGGCGCC
TCGGGCCTCGGCGTCGGCTCCTTCGGCCTCGACTGGAACACCGTGGTGGGCTTCCTCGGC
AACCCGCTGGCGTCGCCGGCGTTCGCCATCTTCAACGTCATGGCCGGCTTCGCGCTCAGC
ACCTACGTCGCCGTGCCGATCCTCTACTGGACCGACACCTACAACGCCAAGCGCTTCCCG
CTCGTGTCGTCGCACGTCTTCAACGCCGCCGGCGGCCGCTACGACACCGCCCGCATCCTC
GACCCGGCCACCTTCACGCTCAACCTCAGGGAGTACGACGCCTACGGCCGCATCAACCTC
AGCATCCTCTTCGCCATCAACTACGGCATCGGCTTCGCGGGCCTCATGTCCACGCTCTCC
CACGTCGCGCTCTACCACGGCAAGGACATTTGGGGCTTGTGGCGGAAGGCAACGGCGGAG
CAGGCGAACGGCGGCGGCAAGGAGCGCCAAGACGTGCACACGAGAATCATGAAGAGGAAC
TACAAGGCCGTGCCACAGTGGTGGTTTCACTTGATGCTGGCCATCGTGATGGCATTGTCG
CTGTACACCTGTGAGGGGTTTGGCCGGCAGCTTCAGCTGCCATACTGGGGTCTCCTCCTT
GCCTGTGCCATCGCCTTCACCTTCACGTTGCCCATCGGCGTCATCTCTGCCACGACCAAC
ATGCAACCAGGGTTAAACATCATCACAGAGCTCATCATCGGGTACCTGTACCCGGGGAAG
CCATTGGCGAATGTGGTGTTCAAGACCTACGGCTACATAAGCATGACTCAGGCGCTGACG
TTTGTGTCGGATTTCAAGCTGGGGCACTACATGAAGATACCGCCCAGGTCCATGTTCATG
GTGCAGCTGGCAGGGACGGTGGTGGCGTCGACGGTGCACTTCGCGACGGCGTGGTGGCTG
CTGACGACGGTGAGGAACATCTGCGACGTGGACAGCCTGCCGCTGGGGAGCCCGTGGACG
TGCCCCGGCGAGGACGTCTTCTACAACGCCTCCATCATCTGGGGCGTCGTCGGACCGCTC
CGGATGTTTGGCCGTCTCGGCAACTACTGGCAGATGAACTACTTCTTCCTCGTCGGCGTC
CTCGCGCCGGTGCCCGTCTGGCTGCTGTCGCGCCGGTACCCGCGCAGCGCGTTGCTCCGG
GACATCAACCTGCCGCTCGTCCTCGCCGGCGCCAGCGGGCTGCTCCCGGCGAGGTCCGTC
AACTTCGTCATGTGGGGGCTCGTCGGGTTCGTGTTCAACCACGTCGTGTACCGCCGGTGC
AGGGCGTGGTGGATGCGGCATAACTACGTGCTCGCCGCGGGGCTCGACGCCGGCGTCGCC
TTCATGGGCGTGCTCACCTTCGTCTCGCTAGGATACTTCGACATATACGGGGTGCAGTGG
TGGGGTGGCGCCGCCGATGATCACTGCCCCTTGGCGTCGTGCCCCACAGCACCTGGGGTG
TTTGCCAGGGGATGCCCGCCTGTACCTTCTTGATTGATCAGGACACCGCATCTACATGTA
TATACTCCATATGACAGATGGTTACTCAAATGTATATATTATATCCTCTTGTCTTCCT

CDS

2202 bp

>Os08t0320200-02 Oligopeptide transporter OPT superfamily domain containing protein.
ATGGAGGAGGAGGTGAACGACCACCCGATCGAGGAGGTCCGGAACACGGTGCCGGTGACC
GACGACCCGTCGGAGCCGTGCCTGACGTTCCGGGTGTGGGTGCTGGGGCTCTCGTCGTGC
GTGTTCCTCGCCTTCGTCAACGAGTTCTTCATGTACCGGACCACGCAGCTGAGCATCGGC
ACGGTGGTGGTGCAAATCATCACGCTGCCCATCGGCCGCCTCATGGCGTCGACGCTGCCG
GCGAGGCGCCTCCGCGTCGGCGGCTGGTCCTTCTCCCTCAACCCGGGGCCCTTCAGCCTC
AAGGAGCATTGCCTCATCATCATCTTCGCCGGCGCCGGCGCCAGCGGCGTCTATGCCATG
AACATCATCGCCATCGTCAAGGTGTTCTACAAGCGCCAGATCAGCCCCTACGCCGCCATG
CTGCTCGCCCAGACCACCCAGTTGCTTGGGTATGGATGGGCCGGATTGTTCAGGAAGTAC
CTGGTTGACTCAGCCTACATGTGGTGGCCGTCAAACCTCGTCCAAGTCACCCTCTTCAGG
GCGATGCACGAGGAGGAGAAGAGGAACAAGGGGCAGCTGACGCGGCTGCAGTTCTTCATC
ATGGTGATGACGTGCAGCTTCGCCTACTATATCGTACCCAGCTACCTGTTCCCGGCGATC
AGCACCATCTCGGTGCTGTGCTGGCTGTACAGGGACTCGGTGACGGCGCAGCAGATCGGC
TCCGGCGCCTCGGGCCTCGGCGTCGGCTCCTTCGGCCTCGACTGGAACACCGTGGTGGGC
TTCCTCGGCAACCCGCTGGCGTCGCCGGCGTTCGCCATCTTCAACGTCATGGCCGGCTTC
GCGCTCAGCACCTACGTCGCCGTGCCGATCCTCTACTGGACCGACACCTACAACGCCAAG
CGCTTCCCGCTCGTGTCGTCGCACGTCTTCAACGCCGCCGGCGGCCGCTACGACACCGCC
CGCATCCTCGACCCGGCCACCTTCACGCTCAACCTCAGGGAGTACGACGCCTACGGCCGC
ATCAACCTCAGCATCCTCTTCGCCATCAACTACGGCATCGGCTTCGCGGGCCTCATGTCC
ACGCTCTCCCACGTCGCGCTCTACCACGGCAAGGACATTTGGGGCTTGTGGCGGAAGGCA
ACGGCGGAGCAGGCGAACGGCGGCGGCAAGGAGCGCCAAGACGTGCACACGAGAATCATG
AAGAGGAACTACAAGGCCGTGCCACAGTGGTGGTTTCACTTGATGCTGGCCATCGTGATG
GCATTGTCGCTGTACACCTGTGAGGGGTTTGGCCGGCAGCTTCAGCTGCCATACTGGGGT
CTCCTCCTTGCCTGTGCCATCGCCTTCACCTTCACGTTGCCCATCGGCGTCATCTCTGCC
ACGACCAACATGCAACCAGGGTTAAACATCATCACAGAGCTCATCATCGGGTACCTGTAC
CCGGGGAAGCCATTGGCGAATGTGGTGTTCAAGACCTACGGCTACATAAGCATGACTCAG
GCGCTGACGTTTGTGTCGGATTTCAAGCTGGGGCACTACATGAAGATACCGCCCAGGTCC
ATGTTCATGGTGCAGCTGGCAGGGACGGTGGTGGCGTCGACGGTGCACTTCGCGACGGCG
TGGTGGCTGCTGACGACGGTGAGGAACATCTGCGACGTGGACAGCCTGCCGCTGGGGAGC
CCGTGGACGTGCCCCGGCGAGGACGTCTTCTACAACGCCTCCATCATCTGGGGCGTCGTC
GGACCGCTCCGGATGTTTGGCCGTCTCGGCAACTACTGGCAGATGAACTACTTCTTCCTC
GTCGGCGTCCTCGCGCCGGTGCCCGTCTGGCTGCTGTCGCGCCGGTACCCGCGCAGCGCG
TTGCTCCGGGACATCAACCTGCCGCTCGTCCTCGCCGGCGCCAGCGGGCTGCTCCCGGCG
AGGTCCGTCAACTTCGTCATGTGGGGGCTCGTCGGGTTCGTGTTCAACCACGTCGTGTAC
CGCCGGTGCAGGGCGTGGTGGATGCGGCATAACTACGTGCTCGCCGCGGGGCTCGACGCC
GGCGTCGCCTTCATGGGCGTGCTCACCTTCGTCTCGCTAGGATACTTCGACATATACGGG
GTGCAGTGGTGGGGTGGCGCCGCCGATGATCACTGCCCCTTGGCGTCGTGCCCCACAGCA
CCTGGGGTGTTTGCCAGGGGATGCCCGCCTGTACCTTCTTGA

Protein

734 aa

>Os08t0320200-02 Oligopeptide transporter OPT superfamily domain containing protein.
MEEEVNDHPIEEVRNTVPVTDDPSEPCLTFRVWVLGLSSCVFLAFVNEFFMYRTTQLSIG
TVVVQIITLPIGRLMASTLPARRLRVGGWSFSLNPGPFSLKEHCLIIIFAGAGASGVYAM
NIIAIVKVFYKRQISPYAAMLLAQTTQLLGYGWAGLFRKYLVDSAYMWWPSNLVQVTLFR
AMHEEEKRNKGQLTRLQFFIMVMTCSFAYYIVPSYLFPAISTISVLCWLYRDSVTAQQIG
SGASGLGVGSFGLDWNTVVGFLGNPLASPAFAIFNVMAGFALSTYVAVPILYWTDTYNAK
RFPLVSSHVFNAAGGRYDTARILDPATFTLNLREYDAYGRINLSILFAINYGIGFAGLMS
TLSHVALYHGKDIWGLWRKATAEQANGGGKERQDVHTRIMKRNYKAVPQWWFHLMLAIVM
ALSLYTCEGFGRQLQLPYWGLLLACAIAFTFTLPIGVISATTNMQPGLNIITELIIGYLY
PGKPLANVVFKTYGYISMTQALTFVSDFKLGHYMKIPPRSMFMVQLAGTVVASTVHFATA
WWLLTTVRNICDVDSLPLGSPWTCPGEDVFYNASIIWGVVGPLRMFGRLGNYWQMNYFFL
VGVLAPVPVWLLSRRYPRSALLRDINLPLVLAGASGLLPARSVNFVMWGLVGFVFNHVVY
RRCRAWWMRHNYVLAAGLDAGVAFMGVLTFVSLGYFDIYGVQWWGGAADDHCPLASCPTA
PGVFARGCPPVPS*

5'UTR

chr08:13941514..13942065 (- strand) : 552 bp

chr08:13940361..13940399 (- strand) : 39 bp

CDS

chr08:13939920..13940360 (- strand) : 441 bp

chr08:13939724..13939821 (- strand) : 98 bp

chr08:13938993..13939566 (- strand) : 574 bp

chr08:13938590..13938868 (- strand) : 279 bp

chr08:13937678..13938487 (- strand) : 810 bp

3'UTR

chr08:13937593..13937677 (- strand) : 85 bp

FASTA

>Os08t0320200-02 class=Sequence position=chr08:13937593..13942065 (- strand)
AGGGGAGAAA CAAGCCTACA GATGATGGCT CGGTCTATCC CGCCGGAGTC CGGTGACGAG AACGTCTCGG CTTCTGCCGA
TGGTGTGTAT GCCTCCTTGT TCATTCTCTG CATGAATTGC CTTTCCTACA CTGGGAATGC AAATGAAATT CTCTCGTGGT
AGAAGATCGA AATTAAGCTA CTAGCTAGTT TCTCTTGGAG AATGAAATCA ACAACAGTTT TCTTCCACTT CCCATTTGTT
CGTGCAAAAT TGCTGCTAAA ATATTTAACG ATTTTACTCA TGTTTCTTTT TTTTTCCCCA ATGGAATCTG AACGGCTCAG
TGTTGCTTTG CTAAAAACAT GAGGGTTTGA GAACTTCTCT CGCAAAGACA TGCAGGCGGC CTATTTTAGG GACAGAAGAT
GACAAAAGAA CATCAAGGAA GAGGGCGTAC GTGTAGAGAA AGACGGTGAA ATATTTTGCC AGCCAGCCGG CCGGCCGGAG
TCCGACGATC GAGCACATTC CGATGGACAC TGCAGGCGGT ACAACAAACC ACGCCTAAAA CCTCCTTTAC TTGTAAGTCA
TCGTCGCAAA GTTCTACCAC AAACAAGTGA AACGCATTGA TCGTCAATTT CGTAAAAACA CTTCAAATGC ATAGATCATA
AGCTTTCAAA TCTCGGTTGC ATatcgtttg ctggttagtt tgttagccat agtcaagatt tgaattttga aactttactt
gggagttctt tttcatcgta atctattttt agcattagct tttaaactgc aaacaaatag atataaaaag ttgtgattAG
TTCATTTTGG AATTTGGGAT TATTTCATTC AATTTTGGGT CATTAGAgga aacactttta atcatttaga tggacatcca
cccatttgtt gcctgtcaaa ttaaatgatt atgatttttt tttaaaaaaa tggataagat atattaataC TTCCTCTATT
TCACAATGAT AAGATATATT AGGGTGCCAT CATTTGGCAT attggtggaa taagctaaac ggtatatttg caaatgaaaa
gtaatttgtg aataaaattt ttatatatgt gttattagcg atctaaaagc aaaggctgaa aaataacctt caatgaaaaa
accctaaaat cagcttcaaa tttaatattg aaaattcaaa ttttggctga taagcatatg aatatgccaa acgatggaga
ccTAATACGT TCcgttccac aatgaatcta gacatatagc attgcctaca ttcatataga tataaagaat ctagacacat
atttgtctag attcattaGA GTATctatat gaatgtgaac agtgctagaa aagtcttaca atatgaaata gggggagtac
ataatatgtc acttcataaa catacaagtt taaatttgac ttctatgagt tctaacaaaa acataaaaaa ttaactctaa
ttagtatacg tatatactca cagttaaatt tgtttttctt acaactcgta aaagttaaat ttgaacttgt ttgtttaagt
gaatattcat attaatctat cttatcttgt caattgtttt gatttattat tttgtaatta tctagttgac atgtaataaa
tatatgaaca tatccaaccg aatgattaaa aGCCCTCTCC GGGTTATCAG CCATAATCAC TATCAGAGTT TTGTGTGTGT
GTGTGTGCGC ACTGCAGAGG AGGGCATGGA GGAGGAGGTG AACGACCACC CGATCGAGGA GGTCCGGAAC ACGGTGCCGG
TGACCGACGA CCCGTCGGAG CCGTGCCTGA CGTTCCGGGT GTGGGTGCTG GGGCTCTCGT CGTGCGTGTT CCTCGCCTTC
GTCAACGAGT TCTTCATGTA CCGGACCACG CAGCTGAGCA TCGGCACGGT GGTGGTGCAA ATCATCACGC TGCCCATCGG
CCGCCTCATG GCGTCGACGC TGCCGGCGAG GCGCCTCCGC GTCGGCGGCT GGTCCTTCTC CCTCAACCCG GGGCCCTTCA
GCCTCAAGGA GCATTGCCTC ATCATCATCT TCGCCGGCGC CGGCGCCAGC GGCGTCTATG CCATGAACAT CATCGCCATC
GTCAAGGTGT TCTACAAGCG CCAGATCAGC CCCTACGCCG CCATGCTGCT CGCCCAGACC ACCCAGGTTG CCACTCATGC
ATTGGTTGAT TAGTAACAAA TCGAAGACCT GATCAAACAC ACATTGATTA ATCCAAAAAT GGCCTTTTAT TTGATTTCAT
ACAGTTGCTT GGGTATGGAT GGGCCGGATT GTTCAGGAAG TACCTGGTTG ACTCAGCCTA CATGTGGTGG CCGTCAAACC
TCGTCCAAGT CACCCTCTTC AGGTAATGGT ACTAATTACC AGCAGTTATT TTGTCGAAAT ATTTGTTTCT GAAAAATATA
TGATGCAAAT GGGGAATGGG CAAACACAAA CTTTATTTTG AGCATTTTTT TTTTTTGCGG GGAAACTTAT AAGCAAAATT
TGGAATGTTT GTCACGCAGG GCGATGCACG AGGAGGAGAA GAGGAACAAG GGGCAGCTGA CGCGGCTGCA GTTCTTCATC
ATGGTGATGA CGTGCAGCTT CGCCTACTAT ATCGTACCCA GCTACCTGTT CCCGGCGATC AGCACCATCT CGGTGCTGTG
CTGGCTGTAC AGGGACTCGG TGACGGCGCA GCAGATCGGC TCCGGCGCCT CGGGCCTCGG CGTCGGCTCC TTCGGCCTCG
ACTGGAACAC CGTGGTGGGC TTCCTCGGCA ACCCGCTGGC GTCGCCGGCG TTCGCCATCT TCAACGTCAT GGCCGGCTTC
GCGCTCAGCA CCTACGTCGC CGTGCCGATC CTCTACTGGA CCGACACCTA CAACGCCAAG CGCTTCCCGC TCGTGTCGTC
GCACGTCTTC AACGCCGCCG GCGGCCGCTA CGACACCGCC CGCATCCTCG ACCCGGCCAC CTTCACGCTC AACCTCAGGG
AGTACGACGC CTACGGCCGC ATCAACCTCA GCATCCTCTT CGCCATCAAC TACGGCATCG GCTTCGCGGG CCTCATGTCC
ACGCTCTCCC ACGTCGCGCT CTACCACGGC AAGCAAGTTT TCCCGCACAA GCTCTTGCTA ACTTAGTACT CCCGTCAGTC
ATAAATATTT GATATGTTTA TGACAAGATT CAGCTAACCA GCTTGCAAAA CTTTTGACTT CAATTTGTTC GAGCAGGGAC
ATTTGGGGCT TGTGGCGGAA GGCAACGGCG GAGCAGGCGA ACGGCGGCGG CAAGGAGCGC CAAGACGTGC ACACGAGAAT
CATGAAGAGG AACTACAAGG CCGTGCCACA GTGGTGGTTT CACTTGATGC TGGCCATCGT GATGGCATTG TCGCTGTACA
CCTGTGAGGG GTTTGGCCGG CAGCTTCAGC TGCCATACTG GGGTCTCCTC CTTGCCTGTG CCATCGCCTT CACCTTCACG
TTGCCCATCG GCGTCATCTC TGCCACGACC AACATGGTCA GCACAAGTAG AATTACTTTC TCTTTCAGCC TTGAATTAAC
GTTAACTAAG CTAGTATAGT AGTAAATTGC ATTATTGTTG GTTGGTTGTT TCTTTCAGCA ACCAGGGTTA AACATCATCA
CAGAGCTCAT CATCGGGTAC CTGTACCCGG GGAAGCCATT GGCGAATGTG GTGTTCAAGA CCTACGGCTA CATAAGCATG
ACTCAGGCGC TGACGTTTGT GTCGGATTTC AAGCTGGGGC ACTACATGAA GATACCGCCC AGGTCCATGT TCATGGTGCA
GCTGGCAGGG ACGGTGGTGG CGTCGACGGT GCACTTCGCG ACGGCGTGGT GGCTGCTGAC GACGGTGAGG AACATCTGCG
ACGTGGACAG CCTGCCGCTG GGGAGCCCGT GGACGTGCCC CGGCGAGGAC GTCTTCTACA ACGCCTCCAT CATCTGGGGC
GTCGTCGGAC CGCTCCGGAT GTTTGGCCGT CTCGGCAACT ACTGGCAGAT GAACTACTTC TTCCTCGTCG GCGTCCTCGC
GCCGGTGCCC GTCTGGCTGC TGTCGCGCCG GTACCCGCGC AGCGCGTTGC TCCGGGACAT CAACCTGCCG CTCGTCCTCG
CCGGCGCCAG CGGGCTGCTC CCGGCGAGGT CCGTCAACTT CGTCATGTGG GGGCTCGTCG GGTTCGTGTT CAACCACGTC
GTGTACCGCC GGTGCAGGGC GTGGTGGATG CGGCATAACT ACGTGCTCGC CGCGGGGCTC GACGCCGGCG TCGCCTTCAT
GGGCGTGCTC ACCTTCGTCT CGCTAGGATA CTTCGACATA TACGGGGTGC AGTGGTGGGG TGGCGCCGCC GATGATCACT
GCCCCTTGGC GTCGTGCCCC ACAGCACCTG GGGTGTTTGC CAGGGGATGC CCGCCTGTAC CTTCTTGATT GATCAGGACA
CCGCATCTAC ATGTATATAC TCCATATGAC AGATGGTTAC TCAAATGTAT ATATTATATC CTCTTGTCTT CCT

Locus: Os08g0320200

Loading...

Locus: Os08g0320200

Loading...